KEGG   Rhincodon typus (whale shark): 109912325
Entry
109912325         CDS       T06055                                 

Gene name
lpar4
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109912325 (lpar4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109912325 (lpar4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109912325 (lpar4)
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109912325 (lpar4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 109912325
NCBI-ProteinID: XP_020367333
LinkDB
Position
Unknown
AA seq 345 aa
MGNDSQNPTCLTNDSFKYTLYGSVYSVVFILGLLTNCTSLYFFSCKMKMRNETTIFMTNL
AVSDLLFVFTLPFKIFYNINRHWPFGDGLCKVSGTAFLTNIYGSMLFLTCISADRFLAIV
YPFRSRAIRTRRNTSIICAGVWLLVLSGGISASLFSTTNIRGNNSSTTCFEGFSKDTWKT
YLSKITIFIEIVGFLIPLLLNLTCSSLVLRTLRKPETLSPIGANKERVLKMIIVHLSIFI
ICFVPYNSILFIYALVRSQAIANCSLERFAKTMYPITLCLATTNCCLDPFVYYFTSEYFQ
KYFNIRPCTKLDSIFKSETPLTVKGEAMADSVNRNGANIHLESQF
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggggaatgacagccagaaccccacgtgtcttaccaacgactcattcaagtataccctg
tatggctccgtgtacagcgttgtatttatcctcgggttgttgacaaactgcacctcactg
tatttcttcagctgcaaaatgaagatgcggaatgagaccacaatatttatgaccaatctt
gcagtctcggacctcctttttgtctttacgctgccctttaagattttttacaacatcaat
cgccactggccgtttggtgacgggctgtgcaaggtctctgggacagcgttcctcacgaac
atatacgggagcatgctgtttctcacttgcatcagtgctgaccgattcctggccatagtt
taccccttcaggtctcgggccatcaggacaaggagaaacaccagcatcatttgtgcagga
gtgtggctcctagtgctcagtgggggaatctctgcatctctattctccaccactaacatc
agggggaataactccagtaccacctgcttcgaaggtttctccaaagacacctggaaaacc
tatctgtctaagatcaccatattcattgaaatagttggatttctcattcctttgctgttg
aatctgacctgctcctcgttggttctgaggactctgaggaaaccagaaacgttgtctcca
attggagccaacaaagaaagggtactgaagatgattattgtgcacttgtccattttcatt
atatgctttgtgccctacaactccatcctgtttatctatgctcttgtgcgttcccaagca
attgcaaactgctccttggagaggtttgccaaaaccatgtatccaatcactttgtgcctg
gctaccacaaactgctgcctcgacccctttgtttattactttacgtcggaatattttcag
aagtatttcaacataagaccctgcacgaagcttgattccatttttaaaagtgaaacacca
ctaacagtgaagggggaggcaatggccgattctgtaaatcggaatggagccaatattcat
ttagaatctcagttttaa

DBGET integrated database retrieval system