KEGG   Rhincodon typus (whale shark): 109913847
Entry
109913847         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04141  Protein processing in endoplasmic reticulum
rtp04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109913847
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109913847
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rtp03000]
    109913847
Transcription factors [BR:rtp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109913847
SSDB
Motif
Pfam: bZIP_1 bZIP_Maf bZIP_2 ZapB GIT_CC YabA
Other DBs
NCBI-GeneID: 109913847
NCBI-ProteinID: XP_020368994
LinkDB
Position
Unknown
AA seq 698 aa
MATDLVNELESRFFPENLLNSEAWDACLYDCETMEEMDDSTDLFRCFDNVTEFNTSLDLD
LDLNLNMDIETSDLPWSQINGDIYSDLRVKLEPLSPGSSRCSDSSLASSCDMPLFPQPHQ
TVNTEPTLPVVKTEDPPTPPCVFGDVLNPPLNTVQLSVVKKENGTSPVKQGPAIQTTAKA
NSIMCNKPNIQPKPVVVTTLTTAPTTSPAKTIILQSVQTSLPVSQQQSLPLKQTIPVSRQ
SVVLAQSDLVRIPVQGLIKVPGVNGVASNCKQANGICNKIAINKSATKPIVPAPTQTETN
TSEIDIKLLKRQQRMIKNRESACQSRKKKKEYLQGLESKLREALNENEKLKRENSLLKKK
LDSIMSENTELKLGSGNRKAVCVMVFLLFVAFTFGPASITEKKPDLFQKPEDSTYVKRHL
LAFKEEPGTESMTEEATKDYTQRDKFSNITMAYSDVKDLVLRDIDRILFPSSDCRQFNKT
ESLRLADELRGWVHRHQIERTKSNEKPKASKEIXTRHVCLFQRAQQRKINLSRFISIHSA
ESSTRLTSSQLQVYQSPEQSYYDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTNRPKM
SLVMPAMAVNESLHNTTRGYEVMMQIDCEVMDTRIIQIKSSSVPPSLRQPQHNGTGSYHP
HSNTSRAPSARRLRPPPLPISAPSTKDPLYLTTEDGEV
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcaacggatctggtgaacgagctggagagtcgcttcttccccgaaaacctgctgaac
agtgaggcctgggatgcctgtctgtatgactgtgaaacaatggaggagatggatgattct
actgatctctttcgctgctttgataacgtcactgagttcaacacaagtttggatttggat
ttggatttgaatttgaatatggacattgaaacatcagacttaccttggagtcagatcaat
ggagacatttattcagacctgcgagtgaagttggaaccactttcaccgggatcctcacgc
tgctcagattcttcacttgcttcctcgtgtgacatgcccctttttcctcagcctcatcag
actgtaaacacggaaccaactcttccggttgtgaaaactgaggatcctcctacaccaccc
tgtgtatttggggatgttctcaacccaccactgaacactgtccagctcagtgtggtgaaa
aaggaaaatgggacctcgccagtcaaacaaggaccagcaattcaaactactgcaaaggcc
aatagcatcatgtgcaacaagccaaacatccagccaaaaccagttgttgtgacaacactg
accactgctccaaccaccagcccagcaaaaaccatcattcttcaatctgtacagaccagc
ttgcccgtgtctcagcaacagagtctgccgttaaagcaaaccattccagtatcgaggcag
tctgtggttctggcccagtcagacctggtaagaattcctgtccagggactgatcaaagta
ccaggagtgaatggggtcgccagcaactgtaagcaagccaatggcatctgcaacaaaatc
gctatcaacaagtccgccaccaaaccaatcgtgcccgcgcctacacagacagaaactaat
acttccgagatcgacatcaagttgctaaagcgccagcagagaatgatcaagaatcgtgag
tcagcctgccagtcccgcaaaaaaaagaaagaatacctccagggtctggagagcaaattg
cgcgaggcactcaatgagaatgagaagctgaaaagggagaactcactgctgaaaaagaag
ctagacagcatcatgtcagagaacacagaattgaaattgggctctggtaatcgtaaagca
gtgtgtgtgatggtctttctgctcttcgttgcattcacttttggacctgccagtataaca
gagaagaagccagatctcttccagaaaccagaagacagtacgtatgtcaagaggcaccta
ctggctttcaaagaggaaccaggtacagagagcatgacagaggaagcgacgaaagattac
actcagagggacaaattcagcaacatcaccatggcttactctgacgtaaaagacttggtg
cttcgtgacattgatcggatcctcttcccttcctcggattgccgccagttcaacaaaacc
gaatcgctcagacttgccgatgaattgcgtggctgggtacaccgacatcaaattgaaagg
acaaagtccaatgagaaacccaaagcgtcaaaagaaatttaaacaaggcatgtgtgtctc
tttcagagggcacagcagaggaagatcaatctgtccaggtttatttcaattcattctgcg
gagtcttccaccaggttgacctccagtcagttacaggtttaccagagccccgagcagagt
tactatgacttcatggatgctatcgatagaagggaagacaccttctatgtggtttcgttc
cgaagggatcacctgctgttaccagctatcagtcacaacaagaccaacaggccgaagatg
tccctcgtgatgccagctatggcagtgaatgagagcctgcacaacaccacacgaggttac
gaggtgatgatgcagatcgattgtgaggtgatggacaccagaattattcagatcaagagc
tcgtcggtgcccccttctctccggcagcctcagcacaatggcacgggttcctaccaccca
cacagcaacaccagcagggcacccagtgccaggaggctacggcccccacccctacccatc
tctgcaccgagcaccaaggacccactgtacctcacaacagaagacggtgaagtgtag

DBGET integrated database retrieval system