KEGG   Rhincodon typus (whale shark): 109914642
Entry
109914642         CDS       T06055                                 

Definition
(RefSeq) sphingosine 1-phosphate receptor 1-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109914642
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109914642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109914642
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109914642
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 109914642
NCBI-ProteinID: XP_020369841
LinkDB
Position
Unknown
AA seq 322 aa
MNPRFNSSAGHGNTSVTWSYWLVLSLGIPQLAINLVSEVCNCSVILTIISARHQHKPIST
LFGSLALSDLLSSSSSFWIALLFIQEPEETIFGSEELLYGYTILGISILSTVYNLMAIGV
ERYLTVADSLRDRCTICHWQTGLAATGSWLLAGLFGGLPLMGWNCLDRDETSSALYRPLC
IDYLVFVTIPNCVLTFACLLVTYVAIIVILKRQKCIIAAQGHVSPRYXVAEARVARKSVI
IWIMTVVSYSPFFSGVLWDAPDHTLLAELHINVYIFRNLAAIMITLNSLVNPIVYTHRLG
KSGISLTCPVNNNIHLQAIKNS
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaacccgcggttcaatagttcggcgggacacggcaatacgtctgtgacttggagctac
tggttagtcctgtcgctaggaatcccgcagttagccatcaatctggtgtctgaggtttgt
aactgttcagtgatccttaccattatctctgcaagacatcagcacaagcccatctccacc
ctgttcgggagcttggccttgtccgacctcctgtcaagctcatcttccttttggatcgcg
ctgctcttcatccaggagccggaggagacgattttcggctcggaagagctgctctatggc
tacactatcctcggcatctccatcctgtccactgtctacaacctgatggctattggcgtt
gagcgatacctgacagtggcggacagtctgagagataggtgtaccatctgccattggcaa
accgggctggcagccacaggcagctggctgctcgctggcctctttggcggactgcctctc
atgggctggaattgtttggacagagacgaaacctcatctgctctctaccggcccctctgt
atcgattacttggtttttgtcaccatccccaactgcgtgctcactttcgcttgtttactg
gtcacctacgttgccatcattgtcatcttaaagagacagaaatgcattattgcagcccaa
ggacacgttagtcccaggtacaragtggctgaagcccgtgtagcgaggaagagtgtgatc
atttggattatgactgtggtctcctacagcccgttcttttcaggcgtcctctgggatgct
ccggatcacaccctcctcgcagagcttcatatcaatgtttatattttcagaaacctcgcc
gctatcatgataacgctgaactctttagttaatccgatcgtctatacacacaggttggga
aaaagcggcatttccttaacatgcccggttaataacaacatccacttacaggcaataaag
aattcctga

DBGET integrated database retrieval system