KEGG   Rhincodon typus (whale shark): 109914885
Entry
109914885         CDS       T06055                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109914885 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rtp03000]
    109914885 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rtp03310]
    109914885 (nr3c1)
Transcription factors [BR:rtp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109914885 (nr3c1)
Nuclear receptors [BR:rtp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109914885 (nr3c1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep GCR
Other DBs
NCBI-GeneID: 109914885
NCBI-ProteinID: XP_020370084
LinkDB
Position
Unknown
AA seq 675 aa
MEGSEMLTSTPPMMQFQPHDGNKSDKQQLDGVGITNGGSGQQESFSQAASDLSELEQSLA
ALNELQDVGNRSKSDTDMGLYPSGCEEDLLGGLDDGGSVDFLPDLEFFPSPRDEKQQGSP
WSLTAFCGDDDSGLLSPLSSEPAPLKDSLVDLQPTEECAASWPIPESRCIERKEDVWAPL
PVTTTAPMKVKQEQESYIELVTPGVIKQEQVSRGYCRAANQAAGAHGPVKEPIYLCSTES
VQTSSNQRPIFSFVPPFTAVASAWEVCQHPNANLSNSRVRNICTGGDALPAKYNSTDLKS
EGSSSSSTASSGPPAKVCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDC
IIDKIRRKNCPACRFRKCLQAGMNLDARKTKKLNKMKAPHTTTSETAVKVASPDSSLVCS
AMPTLTLPMVSILEMIEPDLLYAGYDSSLPDTPNRLLSGLNNLGGLQMISVVKWAKSLPG
FRSLHLDDQMMLLQYSWMSLMVFSLGWRSYQHVNSNMLFFAPDLIFNEERMQQSSMYNLC
KGMSNVALDFRNLKVAYEEYLCMKALLLLGTIPVDGLKSQAMFDEIRTSYIKELGKAIVK
KEGSSSQNWQRFYQLTKLLDSMHDLVEGLLQFCFYTFVESKTLRVEFPEMLVEIISNQLP
KVMAGMAKQLRFHHK
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggaaggcagtgaaatgctgacatctacgccacccatgatgcaattccagccacatgat
ggcaacaaaagtgacaagcagcaactagatggagttggaatcacaaatggaggtagtgga
caacaagagtccttttcccaagcagctagcgacttgtcagagttggaacagagccttgca
gctttgaatgaattgcaggatgtagggaatagatcaaagagtgacacagatatggggttg
tacccaagtggctgtgaagaggatctcttgggtggcctcgatgatggtggctcagtggat
tttctgcctgatcttgagttcttcccatcaccgagagacgaaaagcaacagggcagtcca
tggagcctgactgccttttgtggagatgatgattcgggtttgctgtcccctttgtcctca
gaacctgccccgcttaaggatagtctggtggatttgcagccaactgaagaatgtgctgct
tcttggccaattccagaaagtagatgtattgagagaaaggaggatgtctgggcccctttg
ccagttacaaccactgcccccatgaaggtgaagcaggagcaagagagctacattgaatta
gttactcctggtgttattaaacaggagcaagtcagcaggggttactgcagagctgccaat
caggcagcaggagcccatggtcctgtcaaggaacccatttatctatgcagtacagaatca
gtgcaaaccagtagcaatcagagacccattttcagctttgtaccacctttcacagcagtt
gcttcagcttgggaagtgtgccaacatcccaatgcaaatttgtccaacagtcgagtgagg
aacatctgcactgggggcgacgctttacccgccaagtacaatagcactgatctgaaatct
gaaggaagctcatcatcctctactgcctcctcggggccacctgccaaagtctgtctggtt
tgctcagatgaagcatctggatgtcattacggtgttcttacatgtggcagttgcaaagtt
ttctttaagcgagctgtagaaggacagcataactacctctgtgctggaaggaatgactgc
atcattgataagattcgtcgaaagaactgcccagcttgccgttttagaaagtgcctccag
gctggaatgaatctcgacgctcggaagacaaagaaattgaacaagatgaaggcaccacat
accaccacttcagaaactgcagtaaaagtagcatcaccggattcatctttagtttgttct
gcaatgcctaccctgactcttcccatggtttcgattcttgagatgattgagccagatctc
ttgtacgcaggatatgatagttccctgcctgacacacccaatcgactcctatcaggactg
aataacttgggtggattacagatgatctcagttgtgaaatgggcaaagtctctaccaggg
ttcagatctttgcacctggatgatcaaatgatgttactgcagtattcttggatgtctcta
atggttttcagtcttggttggcgatcttatcaacatgtcaatagcaatatgctcttcttt
gcaccagacctaatcttcaatgaggaacggatgcagcagtcctcgatgtacaacttgtgt
aaaggaatgagcaacgttgcattggatttcagaaaccttaaggttgcttatgaagaatat
ctatgcatgaaggcattattacttcttggtacaattccagtggatggtttgaagagccag
gcaatgtttgatgaaattcgaacctcctatattaaggagctagggaaagccatagtgaag
aaagagggaagctcaagtcaaaactggcaacgattttatcagctgaccaaacttttggat
tcaatgcatgatttggttgaaggattgttgcagttttgtttttacacctttgtggaatca
aagactctgagagtggagttccctgaaatgttggtggaaatcattagcaatcagttacca
aaagtcatggcaggtatggccaaacagctccggtttcaccacaagtga

DBGET integrated database retrieval system