KEGG   Rhincodon typus (whale shark): 109915447
Entry
109915447         CDS       T06055                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109915447
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109915447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109915447
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109915447
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 109915447
NCBI-ProteinID: XP_020370660
LinkDB
Position
Unknown
AA seq 346 aa
MDECFYNRSVWFFYNSTGKELSPIWRTKDKLVVSLGLLVCVIIILANLLVIMAIAINRRF
HFPIFYLLANLAAADLFSGVAYMFLMFHTGPRTIQLSVRTWFFRQSLLDISLTASVANLL
AIAVERHQTIFQFQLHSKMSNQRVTILIGCIWCTAILIGFIPHLGWNCICHLSTCSRMAP
LYSQSYLIFWAVSNLVIFGAMMLNYLHIYYYVRQKTQRMSRHTSFQQRHKDTMMNLMKTV
VMVLSAFVICWTPGLVVLLLDGVDCRSCDILKVEKYFLLLAELNSLINPLIYSYRDEEML
HTFRRILCWPCNRGGTFQDPIKSHILMQQMLTSSQRASSSREHSTL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggacgagtgtttctacaatcgctccgtctggtttttctacaatagcacgggtaaggag
ctgagtccaatctggcgaaccaaggacaagctggtggtgtccctgggcctgctggtctgt
gtcatcatcatcctggccaacctgctggtcatcatggccatagccatcaaccgccgcttc
cacttccccatcttctacctgttggccaaccttgcggctgctgacctcttctctggcgtg
gcctacatgttcctcatgttccacacaggcccacgcaccattcagctcagcgtgcgcacg
tggttcttccgacagagcctgctggatatcagcctgaccgcttcggtcgccaacctcctg
gccatcgcagtggagcgccaccagaccatcttccagttccagctacacagcaagatgagt
aaccaacgcgtgaccattctcattggctgcatttggtgcacagccattctcattggcttc
atcccacaccttggctggaattgtatctgccacctgtctacctgctcgcggatggctccg
ctctacagccaaagctacctaatcttctgggcagtgtccaacctggtcatctttggtgcc
atgatgctgaactaccttcacatttactactatgtcaggcagaaaacccaacgcatgtcc
cgccacacatcgttccagcaacgtcataaagacaccatgatgaacctcatgaagactgtc
gtcatggtcctgagtgcgtttgtgatctgttggaccccaggcttggtggtgttactcctg
gacggggtggattgccgaagctgtgacatcctgaaggtggagaagtacttcctgttgctg
gccgagctgaactccctgatcaaccccctgatctattcgtaccgtgacgaggagatgctg
cacacgttccggaggattctctgctggccgtgtaaccgcggcggtaccttccaggatccc
atcaaatcgcacattctcatgcagcagatgctgacctccagccaacgagcttccagctct
cgggaacactccaccttgtaa

DBGET integrated database retrieval system