KEGG   Rhincodon typus (whale shark): 109916765Help
Entry
109916765         CDS       T06055                                 

Definition
(RefSeq) caspase-1-like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04217  Necroptosis
rtp04621  NOD-like receptor signaling pathway
rtp04623  Cytosolic DNA-sensing pathway
rtp04625  C-type lectin receptor signaling pathway
rtp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109916765
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109916765
   04623 Cytosolic DNA-sensing pathway
    109916765
   04625 C-type lectin receptor signaling pathway
    109916765
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109916765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rtp01002]
    109916765
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109916765
Enzymes [BR:rtp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     109916765
Peptidases and inhibitors [BR:rtp01002]
 Cysteine peptidases
  Family C14: caspase family
   109916765
Membrane trafficking [BR:rtp04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    109916765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD Suc_Fer-like PG_binding_2 Tex_YqgF Lipase_GDSL_3
Motif
Other DBs
NCBI-GeneID: 109916765
NCBI-ProteinID: XP_020372091
LinkDB All DBs
Position
Unknown
AA seq 383 aa AA seqDB search
MEAADQRLKHLRTDLVNGLTKGVIDDLVDEMQEARVINTSESEEILQAQATTKNKARCLI
DTVSKKGPRASEKFIDSLNKADKELCVKLSLCLVKSIGSVVPTTSTLATAELPTSDEWIT
PCTQQHYEEISQKTNEVYQILPKQGRKRLAILINNIDFEKPEMKRKGAEVDEEQMQKLLN
GFGYQVEKHNNLTGEEMKQALAAFSNREEHSQSDSTFVVLMSHGLRDKICGRFHNEAKED
TLHIDNVFNILDNKSCKGLRGKPKIIIVQACRGSNLGYAYVSDSANDEPVADYEEEGPFY
KIHKESDFICFCSTTPDNVSLRHVQNGSIFIQSLVDLMRRNASKYDVEEIFFQVQQSFHN
FARQLPVKERGTLMKKFYLFPGI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagcagaccaaagactgaagcacctgagaacagatttagtgaatggactcacc
aagggagtcattgatgatctcgtggatgaaatgcaagaggcgagagtgatcaacacgtca
gaatcagaagaaattctccaagcacaagcaacaacgaaaaacaaggctcgatgtctcata
gacaccgtttcaaaaaagggaccccgagccagtgaaaaatttattgacagtctgaacaaa
gcagacaaagagctatgtgtgaaactgagcctttgtctggtaaaaagcattggatctgtt
gtcccaaccacttccactttagcaacagcagagttacccacatctgatgagtggataact
ccgtgtacacaacagcactatgaggagatttctcagaagacaaacgaggtataccagata
ttgccaaaacagggaaggaaacgtttggctatactgattaataacattgattttgagaaa
cctgaaatgaagaggaagggtgcagaggtggatgaagaacaaatgcagaaactgctaaat
ggctttggctaccaagtggaaaagcacaataatttaacaggcgaggaaatgaaacaagca
ctggctgcattttcaaatcgtgaggaacactcacagagcgatagcacctttgttgtgctc
atgtcccatgggctccgagataaaatctgtggcagatttcacaacgaagccaaggaagat
actcttcacattgacaatgtctttaatattttagacaacaagagctgcaaaggattgaga
ggaaaacccaaaattatcatcgtgcaggcctgtcgaggatcaaaccttggctacgcctat
gttagtgattctgctaatgatgagcctgtcgctgattatgaagaagagggtcccttttac
aaaatacacaaagaaagtgatttcatctgtttctgctccaccaccccagacaatgtatcc
cttaggcatgtacaaaatggcagcatattcatccaatcattagtcgatttaatgaggcga
aatgcatcaaagtatgatgtcgaggagatttttttccaggtccaacagtcatttcacaac
tttgccagacagctgcctgtgaaggagagaggcacactgatgaagaagttttatctgttt
cctggcatttaa

DBGET integrated database retrieval system