KEGG   Rhincodon typus (whale shark): 109916803
Entry
109916803         CDS       T06055                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109916803
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109916803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rtp04052]
    109916803
   00536 Glycosaminoglycan binding proteins [BR:rtp00536]
    109916803
Cytokines and growth factors [BR:rtp04052]
 Growth factors
  Growth factors (RTK binding)
   109916803
Glycosaminoglycan binding proteins [BR:rtp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109916803
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 109916803
NCBI-ProteinID: XP_020372137
LinkDB
Position
Unknown
AA seq 155 aa
MDAGTVTSLSDLSNSFNHFLVNYKDPKLLYCANGGYFVRILPDGQVEGTRDRGDAYIRLQ
LQAVRRGVVSIQGIECGRYLAMSEMGQLNSSLTLTDECLFLEKLEENGYNTYKSKEYMER
NWYVAIRKNGNAKPGPKTNVGQKAILFLPMPVTSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggatgctggaactgtgacaagtttatcagacttgtccaattccttcaatcactttctc
gtgaattacaaagacccaaagctcttgtactgtgcaaatggaggttactttgttcgaatt
ctccctgacggacaagtagaggggacgagagaccgcggcgatgcatacattcggctccag
ctgcaggctgtaagaagaggagtggtgtcgattcaagggattgaatgtgggcgctaccta
gcaatgagcgaaatgggacaacttaattcctcactgaccctgacagatgaatgtctcttc
ctggaaaaattagaggagaatggttataacacttacaagtctaaggaatatatggaaagg
aactggtacgtcgctattcgaaagaatggaaatgccaaaccgggaccaaaaactaatgtc
ggacaaaaagctatcctgttccttcccatgccagttacaagtgattaa

DBGET integrated database retrieval system