KEGG   Rhincodon typus (whale shark): 109916891
Entry
109916891         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04060  Cytokine-cytokine receptor interaction
rtp04068  FoxO signaling pathway
rtp04144  Endocytosis
rtp04218  Cellular senescence
rtp04350  TGF-beta signaling pathway
rtp04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109916891
   04350 TGF-beta signaling pathway
    109916891
   04068 FoxO signaling pathway
    109916891
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109916891
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109916891
  09143 Cell growth and death
   04218 Cellular senescence
    109916891
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109916891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtp01001]
    109916891
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109916891
Protein kinases [BR:rtp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109916891
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase RseC_MucC
Other DBs
NCBI-GeneID: 109916891
NCBI-ProteinID: XP_020372231
LinkDB
Position
Unknown
AA seq 574 aa
MGLMDSFWVFTLFAASGFSDFLQASVKRFIIPNQWGPNNLCRFCDIEPTNCTNSGVCTVN
CSINSICENEEEVCVSIWRQQDANVTIETLCHNPAIPLYGHLLDDYNNTECKMKEKKVPG
SVFYICSCSIKEECNKNLIFTDDVGIMLSDWQVILEVLLVTLLPLLGLAAVVILAYYWYR
VQRRRKLNKEWAKEQKVRKPGRRRRPPNDRSEGSAMHLDDDQSDISSTCANNINHNTELL
PLELDAVVGKGRFAEVYKAKLRQSTSEQFETVAAKIFHFDEYMSWKNEKEIFSDVNLKHE
NVLQFLTAEERETEMGKQYWLITAYHPQGNLQDYLMRHVVNWEDLCLLGGSLARGIAHLH
SEYTPCGRPKMPIAHRDLKSSNILVKNDLTCCLCDFGLSLRLESSLSVDDLANSGQVGTA
RYMAPEVLESRINLEDIEAFKQTDVYSMALVLWEITSRCTAIGEVKDYEPAFGSKVREHP
CVESMKDVVLRDRGRPEIPNSWLNHQLIQHLCEIIVECWDHDPEARLTAQCVVERFNDLE
QMDKLSGRSCSEEKISEDCSVSETKQNLSAVTVV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgggactaatggattctttctgggtcttcactttatttgcagcctcaggtttttcagac
ttcctccaggcttccgtaaaacgattcataattccgaaccaatgggggccaaataatctt
tgccggttctgtgatatcgagcccaccaattgcaccaacagtggtgtctgcactgttaac
tgcagcattaactccatctgtgagaacgaggaagaagtgtgtgtctctatctggagacag
caagatgctaatgtaactattgaaacactgtgccataatccagccattcctctgtatgga
cacctgctagacgattacaataatacggaatgcaagatgaaagaaaagaaggttcctggc
tctgtgttctacatctgctcatgttcaattaaagaagaatgcaacaaaaatctgatattt
actgatgatgttggtattatgttgagtgactggcaggtgatattggaggttctccttgtc
actcttctcccattgctcggtcttgctgccgtggtgatccttgcttactattggtaccgg
gtccagaggcggaggaagctgaacaaagagtgggcgaaggaacagaaggtcaggaagcca
ggtcgccggcgtcgacctcccaatgaccgtagtgagggcagtgccatgcaccttgacgat
gaccagtctgacatcagctccacctgcgccaacaacatcaaccacaacaccgagctgctg
cccctggagcttgacgctgtggtgggcaaggggcgctttgctgaggtctacaaggccaag
ctgagacagagcacctcggagcagttcgagactgtggcagcaaagatattccactttgac
gagtacatgtcctggaagaatgagaaggagattttctccgatgtcaacctgaaacatgaa
aatgtgctgcagtttctgacagcggaagagcgggagactgaaatgggcaagcagtattgg
ctgatcacggcctaccacccccaaggcaacctgcaagactaccttatgaggcacgttgtg
aactgggaggacctgtgcctactgggaggatcgctggccagaggaattgcacacttacat
agtgaatacacgccttgtggcaggccaaagatgcccattgctcacagggacctaaaaagc
tccaacattctggtgaaaaatgacctgacatgttgtctctgtgactttggattatccttg
aggttggaatcatctctctctgttgatgatttagccaacagtgggcaggtcggtacagcc
aggtatatggctcccgaggtgctggagtcacgaattaacttggaggatattgaggcattt
aaacaaactgatgtttattcaatggcactagttctatgggagattacatcacgatgtaca
gccattggtgaagtgaaagactatgagcctgcctttggttccaaggtccgggagcatccc
tgtgtagaaagcatgaaggatgttgtcctgcgagatcggggaagacctgagatcccgaac
agctggcttaatcaccagcttatacagcatttatgtgaaataattgtggaatgctgggat
cacgatccagaagcacggctgacagcacagtgtgtagtcgaacgcttcaatgatctggag
cagatggacaagctatctggtcggagctgctccgaggagaaaatttcagaagattgctct
gtcagtgagaccaaacagaacctgagtgcagtcactgtggtgtaa

DBGET integrated database retrieval system