KEGG   Rhincodon typus (whale shark): 109919627
Entry
109919627         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04068  FoxO signaling pathway
rtp04110  Cell cycle
rtp04115  p53 signaling pathway
rtp04218  Cellular senescence
rtp04310  Wnt signaling pathway
rtp04340  Hedgehog signaling pathway
rtp04371  Apelin signaling pathway
rtp04510  Focal adhesion
rtp04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109919627
   04340 Hedgehog signaling pathway
    109919627
   04371 Apelin signaling pathway
    109919627
   04068 FoxO signaling pathway
    109919627
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109919627
   04115 p53 signaling pathway
    109919627
   04218 Cellular senescence
    109919627
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109919627
   04530 Tight junction
    109919627
SSDB
Motif
Pfam: Cyclin_N Cyclin_C zf-C2H2_2
Other DBs
NCBI-GeneID: 109919627
NCBI-ProteinID: XP_020375244
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEGEAIRRAYNDPNLINDRVLQTMLRSEENSLPSLSYFKCVQKDIAPSMRKIV
ATWMLEVCEEQKCEEEVFPMAMNYLDRYLSIEMTKKTHLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLVLNKLKWDLASVTPHDFIEHFLNKLPIPKDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSLAAAVHGLHLGDGNSFLSYQSLTDFLSQIIKCD
PDCLRACQEQIESLLETSLRQVQHNSISSETKTVEDELDVSCTPTDVRDVNL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctatgttgcgaaggagaggccatcagaagagcttataacgatccc
aatctcatcaatgatcgtgtcctgcagactatgctcagaagcgaagagaacagcctgccc
tctctcagctatttcaagtgcgtccaaaaagacattgcgccttccatgaggaagattgtt
gcaacttggatgctggaggtttgcgaggagcagaaatgcgaggaagaggtgtttccgatg
gccatgaattatttggacagatacctgtcgattgaaatgaccaagaagacccacttgcaa
ttactgggagctacttgcatgttcctggcgtcaaaaatgaaggaaacgattccgttaaca
gcggaaaaactctgcatttacaccgacaactctatccggcccgaggagttgctgcaaatg
gagctgcttgttctcaacaagctgaaatgggatctagcctctgtgaccccccacgatttc
attgaacacttcctcaacaagctacccatacccaaggacagcaagcagatcatccgcaaa
catgcacagacatttgtggctctatgtgctacagatgtcaagtttatatcgaacccaccg
tcgatgattgcagctggcagtttggccgcagcagttcatggcctccacctgggggatggc
aacagctttctttcctatcagtctctcacagacttcctatcacaaattatcaagtgtgac
ccggattgcttacgggcctgtcaggaacagatcgagtcacttctcgaaacaagtctacgc
caggtacaacacaacagcatatcctcggaaacaaagactgttgaggatgaactggatgtc
tcctgcacaccaactgatgtgcgagatgtaaacctatga

DBGET integrated database retrieval system