KEGG   Rhincodon typus (whale shark): 109921130
Entry
109921130         CDS       T06055                                 

Definition
(RefSeq) uncharacterized protein LOC109921130
  KO
K05461  KIT ligand
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109921130
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109921130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rtp04052]
    109921130
Cytokines and growth factors [BR:rtp04052]
 Growth factors
  Growth factors (RTK binding)
   109921130
SSDB
Motif
Pfam: SCF DUF1180
Other DBs
NCBI-GeneID: 109921130
NCBI-ProteinID: XP_020376764
LinkDB
Position
Unknown
AA seq 388 aa
MARNQEGKIFKSDTMFAFQDDNVDDPGNNILEGDGTAGRKSQDSPVKMWAPLAEEVFAAT
FIDFEKTLINSVIYLHLFLPTIFGGPICKTGNPVTDDIKRIDELVGNLPNDYKIQIKYIS
KIPNVTDTCWLRLTVSEMSFSLDGLLEKFAKNSSNYLIIENLHRVLDGIHNCLYEDRKDY
QEESEFNCEKSNLEPKQYFSYFNEIITAFQLAEDTNPCDAEAVCRPTEPPDAGRGSNSTA
HTLEQTNKTRAPKCERTHPELGRLVRAKRHSLTAKETTPETGDPNTMKGECAHCVTSVNY
LPAIGISIVCIVIITTFLTYLVIRVQKNCERNRRIKSYQMDIEQECKRFDIVNAILDVNG
LEFTSGLVRIPTVNTVLEHSLFAINKSF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggctcgaaaccaagaggggaaaatattcaaatcagacactatgtttgctttccaagat
gataacgtggatgatcctgggaataatattctggagggagatggaacagccggccgtaaa
tcccaggatagcccagttaaaatgtgggcaccactggctgaggaagtatttgctgccacc
ttcattgattttgagaagactttaataaacagcgtgatttacctgcacttgtttctgccc
accatatttggaggacctatatgcaaaacagggaatcccgtgactgatgatataaagcgt
attgatgaattggttggaaacttgccaaatgattataaaatccagataaaatatatttct
aaaatccctaatgtgactgatacatgttggctgcgtttaacagtgtctgaaatgtcattc
agcttggatggacttctcgaaaagtttgccaagaattcgtcgaattatttaattatcgaa
aacctgcaccgggttctggatggtattcacaactgcctatatgaagacaggaaggactat
caggaagaatctgaattcaattgtgaaaagtccaatctggagcctaaacaatacttcagt
tacttcaatgaaatcataactgcattccaattagcagaggataccaatccatgtgatgca
gaggctgtttgcaggccaacagagccaccagacgcagggcgtggctccaactccactgca
catactctggagcagacaaataaaacccgtgcgccaaagtgtgaacgcacacatccggag
ctgggtaggctggtccgtgctaaaagacactctctcacagccaaagagacaactccggaa
acaggagatccaaatacgatgaaaggagaatgtgctcactgtgtcacatcagtcaactat
ttacctgcgattggaatcagcattgtttgcattgtgatcattactacatttctcacatat
ctggttatcagagtgcagaagaactgcgaaagaaacagaaggattaaaagttaccagatg
gacatagaacaggaatgtaaaaggtttgacatcgtaaatgcaattttggatgttaatggc
cttgagtttacttcaggtcttgttaggatcccaacagttaacaccgttttagagcattca
ctgtttgctattaataaaagcttctaa

DBGET integrated database retrieval system