KEGG   Rhincodon typus (whale shark): 109922608
Entry
109922608         CDS       T06055                                 

Definition
(RefSeq) lysophosphatidic acid receptor 6-like
  KO
K04273  lysophosphatidic acid receptor 6
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109922608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109922608
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109922608
SSDB
Motif
Pfam: 7tm_1 TMEMspv1-c74-12
Other DBs
NCBI-GeneID: 109922608
NCBI-ProteinID: XP_020378242
LinkDB
Position
Unknown
AA seq 324 aa
MPNQSLCIFTNSTVTNERTILTLLYSVIIILGLFFNVVALWIFRVHIQQRSGTIFYMRNL
AIVDLLLVCFLPFRIVAYYSQDRLSCEIASVIFLINMYTSIFFLTCISLDRCLATVLPFK
VRIYHLRRAAPWVSGFVWFLTLGCSLPTYLIWKSNSNRTSEYNCLEPIVVTKNLPLIFTL
AFGFGLPFSSVLTSSLLALLKMRKTKLSPNLNIRKTQNMILANFLVFTFCFLPYHVFLGL
YKSLNGKWICGGQQLFQITQILASANTVFDPVIYYFTTEAFQKTHLMRTVHNMICCKHIR
EEQEERTVQSRGTYKKASEVSLFL
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcccaatcagtcgttgtgcatctttacgaacagcacagtcactaacgagagaaccatc
ctcactctgctgtacagcgtgatcatcatcctcgggctcttcttcaacgtggtggctctg
tggatcttccgggttcacatccagcagcgatccgggaccatcttctacatgaggaacctg
gccattgtggatctcctgctggtctgtttcttgcccttccgtatcgtcgcctattacagc
caggacagactgtcgtgtgagattgccagcgtcatttttctgatcaacatgtacaccagc
atcttcttcctgacctgcatcagtctggatcgctgcttggccacggttttgccctttaag
gtgcggatttaccacttacgcagagcagcgccctgggtcagtggctttgtatggttcctg
actttgggctgtagcctccccacgtacctcatatggaaatccaacagcaacaggaccagc
gagtacaattgcctggagcccatcgtcgtcaccaagaatttgccgctgatcttcaccctc
gcctttggcttcgggctccccttcagttcggtgctcaccagctcactccttgccctcctg
aagatgaggaagaccaagctgtcacccaacctgaatattcgcaaaactcagaacatgatc
ctggccaattttctcgttttcaccttttgctttctgccctaccatgttttcctgggcctt
tacaagagcctgaatggcaagtggatctgtggtggtcaacagctcttccaaataacccaa
atcctcgccagtgccaacaccgtcttcgaccccgtgatctactacttcaccacagaggcc
tttcagaaaacccatttgatgaggacagtgcacaatatgatttgttgcaagcatatcagg
gaggagcaggaagagcgcactgtgcagagcagggggacttacaagaaagcatcagaagtc
tccctctttttgtag

DBGET integrated database retrieval system