KEGG   Rhincodon typus (whale shark): 109923052
Entry
109923052         CDS       T06055                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04012  ErbB signaling pathway
rtp04068  FoxO signaling pathway
rtp04110  Cell cycle
rtp04115  p53 signaling pathway
rtp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109923052 (cdkn1b)
   04068 FoxO signaling pathway
    109923052 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109923052 (cdkn1b)
   04115 p53 signaling pathway
    109923052 (cdkn1b)
   04218 Cellular senescence
    109923052 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109923052
NCBI-ProteinID: XP_020378688
LinkDB
Position
Unknown
AA seq 152 aa
MVGGHSEEGKLEFHRKSKVDHVRRNLFGPVDHEQLQQDFQHLLRANIEAAGQKWNYDFGR
EVPSEGTLEWEELKCHDVPAFYRSRVISIGKHSCGVQEPAVDRRSCELPVPQSEQFKAQL
TPEPKRRKQTRITDYYSTKKRYTCPIHHSRKK
NT seq 459 nt   +upstreamnt  +downstreamnt
atggtgggtggacattctgaagaagggaaactggaattccatcgaaagagcaaagtggac
cacgttcggagaaacttattcggccccgttgatcacgagcagctacagcaagattttcag
catttactgcgggccaatattgaagctgccggacaaaaatggaactatgacttcggtcgg
gaagttccgtcggaagggacccttgaatgggaagaattgaaatgccacgatgttccagct
ttttacaggagccgtgttatcagcatagggaaacactcgtgtggggtgcaggagcctgca
gtggacaggagaagctgtgagctgccagtgcctcaaagcgagcaattcaaagctcaactt
acccctgaacccaagagaaggaaacagacccgcataacagattactattcgacaaagaag
agatatacatgcccaatccaccacagcagaaaaaagtag

DBGET integrated database retrieval system