KEGG   Rhincodon typus (whale shark): 109924585
Entry
109924585         CDS       T06055                                 

Definition
(RefSeq) G-protein coupled receptor 87-like
  KO
K08389  G protein-coupled receptor 87
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109924585
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109924585
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 109924585
NCBI-ProteinID: XP_020380172
LinkDB
Position
Unknown
AA seq 226 aa
MIIINFSFYYTVSCSTIFIAFISISRYTMIVKPNNMQLNKFYDTSFARIACTVTWIIATI
PILSLNVNYFIKELDFTNDQDPVCYNIQLQYGKRVSANAFVAVAVIFLIILAMFAFSYAS
IALHLCMVRRKSISQHNRVIHVRAQMIIIAAMTGFIVCHLPYHVYQIITGLQRLRNSSCE
HLLGTHHVKLITLWFVSLSSCLNPILYFLLSKSFVENRSKRKSSDM
NT seq 681 nt   +upstreamnt  +downstreamnt
atgattatcattaacttcagtttctactacactgtcagctgcagcacaattttcattgca
tttatcagcatcagccgatataccatgattgtaaagcccaacaacatgcagctgaataag
ttctatgatacaagttttgcacggattgcctgcactgtcacctggataatagccacaatc
cccattctttcactgaatgtaaactacttcatcaaggaattggacttcaccaatgatcag
gatcctgtttgttataacatccagttgcaatatggcaaaagagtgtctgccaatgcattt
gttgcagtcgcagtaattttcttgattattttagccatgtttgctttttcttatgcatca
atagcactccatctgtgcatggtgaggagaaaaagcataagtcaacacaatcgagtgatc
catgtgcgagcacaaatgatcatcattgctgctatgactggattcatcgtctgccatttg
ccttatcatgtttatcagataatcactgggctgcagagattaagaaacagcagctgcgag
caccttctggggacacatcatgtgaaactgataacactatggtttgtttcattgagtagc
tgcctgaatcctattctgtacttcctactgtcaaaatccttcgtggaaaaccgatcaaag
agaaagtcatctgacatgtga

DBGET integrated database retrieval system