KEGG   Rhincodon typus (whale shark): 109924871
Entry
109924871         CDS       T06055                                 

Definition
(RefSeq) lysophosphatidic acid receptor 3-like
  KO
K04294  lysophosphatidic acid receptor 3
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109924871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109924871
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109924871
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 109924871
NCBI-ProteinID: XP_020380436
LinkDB
Position
Unknown
AA seq 246 aa
MATCYYNETMNFFYNLTSSSREDKLKGSYYLGLGFGIVCCLFIFLSNTMIIIAVVRNRRF
HFPFFYLLANLAAADIFASLAYVFLMFNTGPVSRTLSVHRYLLREALLNVSFCASLYSLL
VIAIERYLSVIKMRLHSSLSKRRVTLLVLVIWGTAIFMATIPNMGWNCICNISTCSSLAP
IYSRSFLTFWALFNLFTLGFVVIIYLRIYIYVRKKTLNLMSHTTGSIKRNKMPMKLIKTI
VTVLGR
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaacctgctactataacgaaacaatgaactttttctacaatctcacaagtagctcg
agagaagataaattgaagggcagctattacctcggtttgggctttggtatagtttgctgc
ctgtttatcttcctgtctaataccatgatcataatcgctgtggtacgcaaccgacggttc
catttccctttcttctacctgcttgccaatctcgcggctgctgacatttttgccagcctg
gcctatgtcttcctgatgtttaatacgggtccagtttcgagaacactgtcagtgcaccgt
tacctgctgcgcgaggcgctactgaacgtgagcttctgtgcatcactgtacagcctactg
gtaatygcgatcgaacgctacctttctgtcatcaagatgaggctccacagcagcctgtca
aaacgacgcgtcactctcctggtcctggtcatctggggaactgctatcttcatggccacc
atccccaacatggggtggaattgcatctgtaacatcagcacttgttcgtcactggccccc
atttacagcaggagtttcctgacattctgggctttattcaacctcttcacacttggcttt
gttgtaataatatatctgcggatttatatctacgtcagaaagaaaaccttaaacttgatg
tctcacaccactggctccatcaaacgcaacaagatgcctatgaagctaataaagaccatc
gtgacggttctgggtaggtga

DBGET integrated database retrieval system