KEGG   Rhincodon typus (whale shark): 109925311
Entry
109925311         CDS       T06055                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109925311 (tgfa)
   04012 ErbB signaling pathway
    109925311 (tgfa)
SSDB
Motif
Pfam: EGF_2 TMEM154 DAG1
Other DBs
NCBI-GeneID: 109925311
NCBI-ProteinID: XP_020380848
LinkDB
Position
Unknown
AA seq 125 aa
SPVAAAVRAHFEDCPATHRHFCFHGTCRFLVQESLAACVCHTGYMGSRCEHADLLAVVAT
QQKQQALTTLLVVSVIVCVLLMVTCVFLHCCQKQRKCELWRRLFTRPEASLLKSMPPSGQ
GDTGV
NT seq 380 nt   +upstreamnt  +downstreamnt
attctccggtagccgctgctgttcgggcccattttgaggattgtcctgcgactcacagac
acttttgtttccatgggacctgtcggtttttggtgcaggagtcgttggcggcctgtgtct
gtcacactggctacatgggctcccgatgtgagcatgccgacctcctggctgtggtcgcga
cccagcagaaacaacaagccctcactacactcttggtggtatctgtcatcgtctgtgttc
tcctgatggtaacctgtgtctttctgcactgctgtcagaaacagaggaagtgtgagctgt
ggcggaggttatttacccggcctgaggccagccttctgaagagtatgcccccaagcggac
agggagacacaggagtatga

DBGET integrated database retrieval system