KEGG   Rhincodon typus (whale shark): 109925555
Entry
109925555         CDS       T06055                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
rtp  Rhincodon typus (whale shark)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 109925555
NCBI-ProteinID: XP_020381080
LinkDB
Position
Unknown
AA seq 410 aa
MAELIELRDLREDTLSPSSRSVYRSSGLERTNAMRISPRSRACSVQDMGKAARQERKSRQ
RLLVVDQEPRLTERLGEGHDFNPCTQTQPSWCDLCGDFIWGLYKQSLQCANCKFRCHYRC
RPLIQLDCNRPKTKRSDVTENTLEQDTNVMTWTSTSSSGYCSQEEDSEFEQFFTARTSFI
KKPRKYKDECIDWKKEVLSRDEIEPKIQEYNSQINNDLLMTLNSDGTYTGFIKVQLKLVR
PISVSANMKPQSIYDAKKAMGPAHPQPIKRRTSFYLPKDTVKHLHISSHTKASEVIKALL
NKFMVVDNPRKFALFERVEKDDQVYTRKLSDDEHPLYLRLLAGPDEKMLSLVLKENETGE
VNWDAFTVPELQNFLRILQREEEEHVRQMFGKYARCKQKMQEELANRSPG
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcggagctgatcgagctgcgggacctgagagaggacacgctgagtcccagcagccgc
tcggtgtaccgctcgtccggtttggagaggaccaacgccatgaggatcagccccaggagc
cgggcttgcagcgtccaggacatgggtaaggcggccagacaagagcgcaagagccggcag
cggttgctggtggtggatcaggagccgagactgactgagagactgggggaaggacacgat
ttcaacccttgcacccagacacagcccagctggtgtgacctgtgcggcgacttcatctgg
ggtctatacaaacaaagtctgcagtgcgcaaattgtaaattccgttgtcactaccgctgc
cgacccctgattcagttggactgtaaccggccaaagaccaagagatcagatgtcacggaa
aacacactggaacaagacacaaatgtgatgacgtggaccagcactagcagcagtggttac
tgcagtcaagaagaagactcagagtttgaacagttcttcactgccaggacctccttcatc
aagaaacccaggaagtacaaggatgagtgcattgattggaagaaggaagttctttcacga
gatgaaattgaacccaagattcaggagtacaactctcagatcaataacgatctcttgatg
acgctgaacagtgacggaacatacaccgggttcattaaggttcagctgaagttggtaagg
cctatctccgtgtctgcgaacatgaagcctcaatcaatctacgacgccaagaaagccatg
ggaccggcacacccgcagccaataaaacgccgcacgtccttctacctcccgaaggacacc
gtgaagcacttgcacatcagcagccacacgaaggccagtgaggtgatcaaagcgctgctc
aacaagttcatggtggtggacaatccccgcaagtttgccttgtttgaacgggtggagaaa
gatgaccaagtttacactcgtaagctttctgatgacgagcatcccttatacctgcgactg
ttggctgggccggatgagaaaatgctaagccttgtcctcaaggagaatgagacgggagaa
gtgaattgggatgccttcactgtgcctgagctgcagaacttcttgcgaatccttcagcgc
gaggaggaggagcatgtcagacagatgtttggaaagtatgcccgctgcaagcaaaaaatg
caagaggagcttgccaaccggtccccgggctga

DBGET integrated database retrieval system