KEGG   Rhincodon typus (whale shark): 109925950
Entry
109925950         CDS       T06055                                 

Gene name
lpar5
Definition
(RefSeq) lysophosphatidic acid receptor 5
  KO
K08390  lysophosphatidic acid receptor 5
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109925950 (lpar5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109925950 (lpar5)
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109925950 (lpar5)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 109925950
NCBI-ProteinID: XP_020381432
LinkDB
Position
Unknown
AA seq 331 aa
MGENTTPTALPDRTLPNCTEHEVAHELQLVWHGAVLAVGLPLNAVALLVFTRLFTRANQT
VVYLANLAACDLLFTLALPLRLYFYAKGEWPFGDVLCQAAGSLFQINLSGSSLFLACISA
DRCLALAYPLRSRHLRRPRVAWKACGAVWAAIVLGSVPVSLAHDASRCRGAEGRTETRCF
EGFSGREWRKELLPLVAAQFLLGFLVPLGVVLCCSARTLAALRGPSAPSPPFAGRRRRAL
HLLVVNAALFVLCFLPYNVALLAYSLVRATKEGRPGGLRWALQLTMLPTCANCCLDPLVY
YFTAEGFRRTLRARAAGEGGGRECEEGERLA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgggtgagaacaccacccccactgccctcccagaccggaccctgcccaactgcacggag
cacgaggtggcgcacgaactccagctggtgtggcacggggcggtgctggcggtggggctc
cccctcaacgcggtggcgctgctggtgttcacccgcctcttcacccgcgccaaccagacg
gtggtctacctggccaacctggcggcctgcgacctcctcttcaccctggcgctgcccctc
cgcctgtacttctacgccaaaggggagtggcccttcggcgacgtcctgtgccaggcggcg
ggctccctcttccagatcaacctgtcgggcagctccctcttcctcgcgtgcatcagcgcc
gaccgctgcctggcgctggcctacccgctgcggtccaggcacctgcggcgcccccgggtg
gcctggaaggcgtgcggcgccgtctgggccgccatcgtcctggggagcgtgcccgtctcc
ctggcccacgacgccagccggtgccgcggcgccgaggggaggacggagacgcgctgcttc
gaggggttctcggggcgcgagtggaggaaggagctgctgcccctggtggcrgctcagttc
ctcctgggcttcctggtgcccctgggggtggtgctttgctgctcggcgcggaccctggcg
gcgctgcggggcccctcggcgccctcgccccccttcgcgggccgcaggaggagggccctg
cacctcctggtggtcaacgcggccctcttcgtcctctgcttcctgccctacaacgtggcg
ctgctggcctacagcctggtgcgagccaccaaggaaggtcggccgggggggttgcgctgg
gccctgcagctcaccatgctgcccacctgcgccaactgctgcctggaccccctggtctac
tacttcacggccgagggcttccgcaggaccctgcgcgccagggcggccggggagggtggc
gggcgggagtgcgaggaaggggagaggctggca

DBGET integrated database retrieval system