KEGG   Rhincodon typus (whale shark): 109926021
Entry
109926021         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: P2Y purinoceptor 14-like
  KO
K08389  G protein-coupled receptor 87
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109926021
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109926021
SSDB
Motif
Pfam: 7tm_1 Saf_2TM
Other DBs
NCBI-GeneID: 109926021
NCBI-ProteinID: XP_020381508
LinkDB
Position
Unknown
AA seq 337 aa
MNTTHDTTSNHTFCPRDSKIAEVVYPILYSIIFIISFTLNSLAIWIFFKIKKTRSFDFYL
KNLAVSDLLMTLTYPFKVLSKSDLAPWQLTWFVCRYSEVIFHLSMYASILFLSLISLDRC
LKIVKPFRNSKVHDINHARVFSAGVWLLVLALGVPNSILTNKKATAVNVKHCTSLKSSFG
KHWHEAVIYICTGIFFIGFLILVVCYIFIMKEILKSKKTFNTATNKNCKTNQNIAWVVAV
FFICFVPYHLWRLSFTVGQIHGNFSCTVKSVRFHGERVTLFLAACNGCLDPIIYFFMSKS
FHELLLHKIYVKTEIPGTQLCGNYKRPQGHVSCDSTV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaatacaacacatgacacaacctcaaatcataccttctgcccaagagacagcaagatt
gcagaagtggtttacccaattctctactcgatcattttcatcatcagcttcacactaaac
agtctggcgatctggatattcttcaagatcaagaaaacacggagttttgatttctatctt
aaaaacctggctgtatccgacctgttaatgacgctcacgtatccatttaaggtactcagc
aagtcagacctggcaccctggcaactaacctggtttgtgtgccgctactcagaggtgatt
ttccatctcagcatgtatgccagtatattgttccttagtctgatcagtctggatagatgc
ctgaaaattgtgaaaccgttcagaaactccaaagtgcatgacattaaccacgcaagggtg
ttttctgcaggagtgtggctacttgtactagctttgggggttccaaacagcattctaacc
aacaaaaaggccaccgcagtaaacgtgaaacactgcacctcgctcaagagctcttttggg
aagcactggcatgaggcagtgatctacatctgcacaggaatattcttcatcggcttcctc
atcctggtcgtttgttacatcttcatcatgaaggaaatccttaagtcaaagaaaacattc
aacacggccaccaacaaaaactgcaagacgaaccaaaacatagcctgggttgttgctgtc
tttttcatttgctttgtgccttatcacctgtggagactgtcattcactgtcggtcagatt
cacggaaacttcagctgcactgtcaaaagtgtcaggtttcacggggagagagttacgcta
ttcctggcagcttgcaacggatgcctcgaccccatcatttacttcttcatgtccaagtca
ttccacgagttgctgctccacaagatctatgttaaaactgaaattccaggcacgcagctg
tgcggcaattataagaggcctcagggtcatgtcagctgtgacagcactgtgtaa

DBGET integrated database retrieval system