KEGG   Rhincodon typus (whale shark): 109927199
Entry
109927199         CDS       T06055                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00220  Arginine biosynthesis
rtp00330  Arginine and proline metabolism
rtp01100  Metabolic pathways
rtp04020  Calcium signaling pathway
rtp04146  Peroxisome
rtp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109927199 (nos2)
   00330 Arginine and proline metabolism
    109927199 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109927199 (nos2)
   04020 Calcium signaling pathway
    109927199 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109927199 (nos2)
Enzymes [BR:rtp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109927199 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 109927199
NCBI-ProteinID: XP_020382727
LinkDB
Position
Unknown
AA seq 1125 aa
MLCPWTFLQRPRYKGKYDHGAKSTVDLNNNEIDTSKEKSLANGRIPNFKTDRAGPEPIPA
KGPMRCPYAPKFVKLTNMENGSILQDTLHQKAVRNMPCQSSSCRGALMTPKAMTRQTRDK
PVPPEEILPQAIDFIKQYYESFKSPRIEEHLARIEEVTKSITRTGTYDLTYEELVFATKQ
AWRNAPRCIGRIQWSNLHVFDARKCTTAKEMFEHMCTHIKYATNDGNLRSTITIFPQRTD
GKHDFRIWNSQIVRYAGYQLPDGSIIGDPAGVAFTQVCIDLGWTPRFGRFDVLPLVIQAN
GQDPEVFEIPPELILEVEIEHPRFDWFKEMGLKWYALPAVANMLLEVGGLEFPGCPFNGW
YMSSEIGVRDFCDVQRYNALEEIGKKMGLETNNLASLWKDQAVVEINIAVLHSFQKKNVT
IMDHHTAAESFMKHMENEFRLRGGCPGDWVWLVPPISGSITRVFHQEILNYILSPFFYYQ
VDAWKTHVWHDESRRPKKNEIQFKHLATAALFSSILMRKTMAKRTKATILYATETGKSET
FAKKLRTLFNGAFNVKVVCMDDYDLNDLSQESLVLIVASTFGNGDSPGNGEVFKKSLFTK
KPLKPYTFSYAIFGLGSRMYPQFCAFAHTLDNKLAQLGATQLSPTGEGDELGGQEESFVD
WAITTFKMACKAFHVRGKVELGQFKSTTKSDVWDPSRYRFATETRPLDLCAALSKMQGKK
ILPMKFKLMKNLQSSKSSRSTILVELSCTDTKELQYLPGEHVGVFPQNQKALVNALIERL
KGTPSSHQCIQVEVNNGNSIKDWKVDERLPACSLSQAFTHFLDITTPPGPQLLKKFAQLA
TDESEKNRLLELSQNAQEYEKWKSFNSPNILEVLEEFQSIQCPALFLLTQLILLKPRYYS
ISSSLDMNPGEVHLTVAVVNYRTRDGEGPMHHGVCSTWLNTMETGELVPCYVRSTAGFHL
PKNQSKPCILVGPGTGIAPYRSFWQQREHDSEKRGIKAGPMTLVFGCRNPELDHIYKEET
LALKDKGILKGVYTAYSRQPGKQKTYVQDILREQLASEVYNILYEGNGHIYICGEIKMAQ
DVTETLKGIIAKQGGMSIEDAEEFLTKLKNQKRYHEDIFGATFQK
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgctgtgtccttggacttttctacaaagacccaggtacaagggcaaatatgatcacgga
gcgaagtcgacagtggacctgaacaacaatgaaattgacaccagcaaagaaaaaagcctt
gccaatggacgtattccgaactttaagactgacagagcgggccctgagccaattcccgcg
aaaggacccatgcgttgtccttatgcccctaagtttgtgaaattgacgaacatggagaat
gggagcatcttgcaggataccctgcatcaaaaagcagtcaggaacatgccgtgccagtct
tcctcctgcaggggtgctctaatgaccccgaaagccatgaccagacaaacccgagacaag
cctgtaccaccagaggaaatcctgcctcaggcaatagacttcatcaagcaatattacgaa
tccttcaaaagccccagaatcgaggagcacctggcccgaatcgaggaggttaccaaaagc
atcacaaggacgggcacatacgatctgacctacgaggaactggtgttcgcaaccaagcaa
gcctggcgcaatgcccctcggtgcattggccgcatccaatggtctaatctccatgtgttt
gacgctcggaaatgcaccactgcgaaggagatgtttgagcacatgtgcacccacatcaag
tatgcaaccaatgatggaaacttaagatccaccatcaccatcttccctcaaaggactgac
ggaaaacatgacttcagaatttggaacagccagatagtccgttatgcagggtaccagtta
cccgatggctctatcattggagatccagctggagttgcattcacacaggtgtgcattgac
cttggctggaccccccgttttggtcgcttcgatgtgcttcctttagtcattcaggccaat
ggtcaggatccagaagtttttgagattccaccagagctcattcttgaagtagaaattgag
cacccaaggtttgattggtttaaggaaatgggtctcaagtggtatgctctacctgctgtg
gccaacatgctgctggaagttgggggtctggagtttcctgggtgtcctttcaatggctgg
tacatgagctctgagattggtgttcgagacttctgtgatgttcagcgatacaatgcactg
gaggaaattggtaagaagatgggattagaaacaaacaatctggcgtctctgtggaaagac
caagcggtggtggagatcaatattgctgtgctgcacagcttccagaaaaagaatgtgacg
attatggaccaccacacagccgcagagtccttcatgaagcacatggagaacgagtttcgg
ctcaggggaggctgcccaggtgactgggtctggcttgtcccacccatttctggaagcatc
acacgagtgttccatcaggagattctgaactacatcctcagccctttcttttattatcag
gttgatgcatggaaaacacatgtctggcatgatgaaagccggagaccaaagaagaatgag
atccaattcaaacatctagcgacggcagcactgttcagctccattctgatgcgaaagacc
atggccaaaaggacaaaggcaacaatcctgtacgcaacagaaacaggaaagtcagaaacc
tttgccaaaaagctgcgcaccttgttcaacggcgccttcaatgtcaaggttgtctgcatg
gatgattatgatctgaatgacctgagtcaggagtcactggttttgatagtggcaagtacc
tttggaaatggagattcacctggaaatggagaggtgtttaagaaatccttgtttacaaag
aagccattgaaaccatatacattcagctatgccatctttggacttggctcccgcatgtac
ccacagttctgtgcattcgcccacaccctcgataacaagctggcacaacttggggcaact
cagttgtcccctacaggagaaggcgatgaacttggaggccaggaggaatcctttgtcgac
tgggctatcaccactttcaagatggcctgtaaagccttccatgtgcgtgggaaggtggaa
ctgggtcaattcaaatcaacaaccaaaagtgatgtctgggatcccagccgatacagattc
gcaacagagacaaggcccctggacctatgtgcagctctctccaaaatgcaaggaaagaaa
attctgcccatgaaattcaaactgatgaaaaatctgcagagctcaaaatccagccggtcc
accattctggtcgagctatcctgcacagacaccaaggagctccagtatctgcctggggaa
cacgttggagttttccctcagaatcaaaaagctcttgtcaatgcattgatcgaaaggctc
aaagggacaccaagctctcaccagtgtatccaagtggaggttaacaatggaaatagtatc
aaggactggaaggtagacgagagactaccggcttgcagtctctcacaggcttttacccac
tttctggacattaccaccccacctggccctcagctcctgaagaagttcgcccagttagca
acagatgaatcagagaagaatcgactgctggaactgagtcagaatgcccaggagtatgag
aaatggaaatctttcaacagccccaacatcctagaagtcctggaggaatttcagtccatc
caatgtcctgccttgttcctcctcacacaactaatactgctcaagcccagatattactcc
atcagttcatccttagatatgaacccgggagaagtccatctgacagtcgctgttgtcaac
tacaggacgagagatggcgaaggtcctatgcatcacggtgtctgcagcacctggttgaac
acaatggaaacgggtgaactggttccatgttatgtgcgcagcactgcgggattccacctg
ccaaagaatcaatcaaagccctgcattctggttggcccaggaacaggaatcgctccatac
cgaagcttctggcaacagagagagcacgactccgagaaacgaggaatcaaagccggtccc
atgactttggtgtttggctgtcggaacccagagttggatcatatttacaaagaagaaacc
cttgcacttaaagataaaggcatcttgaagggtgtttacacagcttactccagacagcca
ggaaaacaaaagacatacgtccaagatattcttcgggagcagctggcctctgaagtctac
aacatactgtatgaaggaaatgggcacatctacatctgcggtgaaatcaaaatggcacaa
gatgtcactgaaactctgaaaggcatcattgctaagcagggtggcatgagtattgaggat
gctgaggagttcctcacaaagctgaagaaccagaagcgatatcacgaagacatctttggg
gcaacgtttcagaaataa

DBGET integrated database retrieval system