KEGG   Rhincodon typus (whale shark): 109927411
Entry
109927411         CDS       T06055                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04020  Calcium signaling pathway
rtp04144  Endocytosis
rtp04510  Focal adhesion
rtp04540  Gap junction
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109927411 (pdgfra)
   04020 Calcium signaling pathway
    109927411 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109927411 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109927411 (pdgfra)
   04540 Gap junction
    109927411 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109927411 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtp01001]
    109927411 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rtp04090]
    109927411 (pdgfra)
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109927411 (pdgfra)
Protein kinases [BR:rtp01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109927411 (pdgfra)
CD molecules [BR:rtp04090]
 Proteins
  109927411 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C1-set Ig_4 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 109927411
NCBI-ProteinID: XP_020383017
LinkDB
Position
Unknown
AA seq 1095 aa
MDIFWKIFLIVDCLFLEVFKGPQLVECQTVPDVYPSTVEIRVALHTSFSLKCSGENEVDW
ELPVYESFEENISRKDENNNSGNFVKSLEVHNATGIYTGRYTCYYPSLQLDEEIEGRDIY
VFVPDPDYPFIPQAYFENIVIAAEGETAEIPCRVSDPDVHVTLLNVDTNTMIATTYNNKE
GFSGLFKEGTYTCITTINGVEHRSEEYIVNRFKVADDLHVEIEAEKTVVKVGEPIFVTCL
VMDNEVVNIDWNYPRKNKGTEAHQVLKEVRQPSLKIMKTLQIEKATLEDTGLYECSVLHA
TQDTKKLKQVHIHVSDKGFINLDPNYGTEEFADLHEVKQFVVNIEAYPEPTVSWLKDNIT
LQEDNNEVMINTVKIQEIRYQSNLTLIRAKKQDSGAYTIVVKNEDNSTNHTFYLQVKVPA
KIINLVDVHHGSASGQIVSCSADGTPSPEVEWLICTDLKKCANDSLLWNVLHNNSSDISI
ETHQTKKNTIESKLTFQKVDNTVAVRCIAKNELAAVAREVKLVAHNLHSELTVAAAVLVL
LVIVIISLIVLVVVWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDTRWEFPRDGLV
LGRILGSGAFGKVVEGTAYGLSXSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPH
LNIVNLLGACTKAGPIYIITEYCFHGDLVNYLHKNRDSFISRYSEKGKKEVDIFGINPAD
ESTRSYVILSFENNGEYMDMKQAENTQYVPMLERKGSSKYTDIQQHIYDHPPSQKNKSLT
ETSEAWNPLLDDSSDGLSFMDLISFTFQVAQGMEFLASKNCVHRDLAARNVLLAQGKVVK
ICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTSLSDVWSYGILLWEIFSLGG
TPYPGMMVDSNFYNKIKSGYRMTKPEHASSDVYDLMVKCWNSEPEKRPSFTRLAEIVGKL
LPENYKKSYKQLNDEFLKSDHPAVARMRAESSDSYIGVTYTNEDKKKDRESGFDEQRLSA
DSGYIIPLPDIDPVTDSEPGSSRNRHSSQTSEESAIETGSSSSTFIKREDETIEDMEMMD
DVAIDPSDLVEDSFL
NT seq 3288 nt   +upstreamnt  +downstreamnt
atggacatattctggaagatattcctgatagtggattgcctcttcctggaagtcttcaaa
gggccccagctggttgagtgccagacagtaccagatgtttaccccagcacagttgaaata
agagttgctctccatacgtcattcagcctgaagtgctccggggagaatgaagtggattgg
gagttgccagtttacgaatcttttgaggagaatatcagyagaaaagatgaaaacaacaac
agtggaaactttgtgaaatcactagaggtccataatgcaacaggaatttatactggcagg
tacacctgctattacccatcactccagctcgatgaggagattgagggacgagatatctac
gtttttgttccagatcctgactatccttttatcccacaagcgtattttgaaaatatagta
atagcagcagagggtgaaactgcagaaatcccatgtcgtgtatctgatccagatgtccat
gtcactctgcttaatgtcgatactaataccatgattgctacaacctataataataaagaa
ggattcagtggcctcttcaaagaggggacatatacctgtatcacaacaatcaatggtgtg
gagcacagatcagaagagtacattgttaatagatttaaagtggcagatgaccttcatgtt
gaaatagaagctgagaaaaccgtagtgaaagtgggtgaaccaatctttgtgacatgtctg
gtaatggataatgaagtggtgaacatagactggaattatccaaggaaaaataaaggaact
gaggcacaccaagttcttaaggaagtaagacaaccaagcttaaaaataatgaagactttg
caaattgagaaagccactctggaagatactggactctatgaatgttctgtgttacatgca
actcaagataccaagaaattaaaacaggttcacatccatgttagtgacaaaggatttatt
aatttggatcccaactatgggacagaagaatttgcagacctacatgaagtcaagcagttt
gtggtgaacattgaggcttatccagagcccactgtatcatggctgaaagacaatatcacc
ttgcaagaagataacaacgaggtgatgatcaacacagtaaaaatccaggaaattaggtat
caaagtaacctgaccttaattcgtgcaaagaaacaagacagtggtgcttacactattgtt
gttaaaaatgaagataatagtaccaatcatacattttacttacaggttaaagtgcctgca
aaaatcatcaatcttgttgatgtccaccatggttctgcgagtggccagatagtttcatgt
tcagcagatgggacaccaagcccagaggttgaatggctgatatgtacagacttaaaaaag
tgtgctaatgactcattgctctggaatgttctccacaacaattccagtgatatcagtatt
gagacccatcagaccaagaaaaatactatagaaagcaagctgacctttcagaaagttgat
aacacagtggctgtgagatgcattgcaaagaatgaacttgcagccgttgcacgtgaagtc
aaactggtggctcacaatctccattctgagttgacggtggctgccgcagtcttggtgttg
ttggttattgtaatcatttctctgattgtgctcgttgtagtttggaaacagaaaccacga
tatgagataaggtggagagtcattgaatcaataagtccagatgggcacgaatacatttat
gttgatcccatgcaacttccctatgatacaagatgggagtttcctagggatggacttgtc
cttggacgaatacttggctctggggcctttggaaaggtagttgaaggaactgcttatggt
ttaagtcrctcacagcctgttatgaaagttgctgtaaaaatgttgaaacctacagcccga
tccagtgagaaacaagctctgatgtcagaactgaagataatgactcatctaggcccacat
ttaaacattgttaacctgctaggagcttgtaccaaagcaggtcctatctacattatcact
gagtactgtttccatggagatttggtaaattacctacataagaaccgagacagctttata
agtcgatattctgaaaagggaaaaaaggaagtggatatttttggtataaatcctgctgat
gaaagcacaagaagttatgtgatcctgtcctttgaaaacaatggggaatacatggacatg
aaacaagctgaaaatacccagtatgtaccgatgttggaaaggaaaggcagttccaaatac
accgatatacagcaacacatttacgatcacccaccatcacagaaaaataaatcattgaca
gagacaagtgaagcttggaaccctctcctagatgacagctcagatggcctctcctttatg
gatttaatcagcttcacctttcaagttgcccaaggaatggagtttctggcttctaaaaat
tgtgtacatcgtgatctggcagctcgtaatgttctccttgcacagggaaaggttgtcaag
atctgtgactttggtctggcacgggacatcatgcacgattccaactatgtttctaaaggc
agcacatttttaccagtaaaatggatggcacctgaaagcatatttgataacctgtacact
tcactaagcgatgtctggtcttatggcattcttttatgggaaatattctccttgggtggt
acgccatatccaggaatgatggtggactccaacttttataacaagataaaaagtggctac
aggatgactaaaccagaacatgcttcttcagatgtctatgacctgatggtgaagtgttgg
aatagtgagcctgagaagaggccttcctttacacgtcttgctgaaattgttggcaagttg
ttaccagagaactacaagaagagctataaacagttgaacgatgagtttttgaagagtgac
catcctgctgttgctcgcatgcgggcagaatcaagtgattcttacattggagttacctac
accaatgaagataaaaagaaagatcgggaaagtggatttgatgagcaaagactaagtgct
gacagtggatacatcatcccactgcctgatattgaccccgtcacagacagcgaacctggc
tcttcaagaaaccgacacagttcccagacatcagaagaaagtgcaatcgagacaggttcc
agcagctcgacttttataaagcgtgaggatgaaaccatagaagacatggaaatgatggat
gacgtagcaattgatccctcagacctagtggaagacagtttcctgtaa

DBGET integrated database retrieval system