KEGG   Rhincodon typus (whale shark): 109928447
Entry
109928447         CDS       T06055                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04068  FoxO signaling pathway
rtp04217  Necroptosis
rtp04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109928447 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109928447 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109928447 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rtp03000]
    109928447 (stat3)
Transcription factors [BR:rtp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109928447 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 109928447
NCBI-ProteinID: XP_020383976
LinkDB
Position
Unknown
AA seq 754 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAAWIETQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRKIKQYLQNRYLERPMEIARIIARCLWEEARLLQVAT
SVSQQAGQSPHHSSVVTEKQQILEHNLQDVRKRVQDLEHKIKILENLQDDFDFNYKTLKS
QGDVQDLNGNSQAATRQKMAQLEQMLTALDQMRRQIVTDLAALLSTMEFVQKTLTDEELA
DWKRRQQVACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVHH
RPVLEERIVELFRSLIKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQ
LKIKVAIDKDSGDGSALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLASLIVTEELH
LITFETEVYHQGLKIDLETSSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPP
VATWDQVAEILSWQFSSTTKRGLNMEQLGTLAEKLLGPGVNYSGCQITWAKFCKENMPGK
AFSFWVWLDNIIDLVKKFILSLWNDGYIMGFISKERERALLNVKPPGTFLLRFSESNKEG
GITFTWVEKDINGKTQIQSVEPYTKQQLTNMSFADIIISYKIMDATNILVSPLVYLYPDI
PKEEAFGKYCCSEPQEAIDPNDPETFAYLKRKFICVTPTNSGNTSDLFPMSPRTLDSLMH
CGSNNEGPEQGAAGGLDSITLDMEFGTECAASPM
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggcacagtggaatcagctacagcagttggataccagatatctggaacaactgcaccaa
ctctacagtgacagcttccccatggaattgaggcagtttcttgcagcttggattgagacc
caagattgggcatatgctgcaagcaaggaatcacatgctacactagtgttccataatctg
ttgggtgagattgatcaacagtacagcagatttctacaggaatctaatgtcctgtatcag
cacaatctgcggaagattaaacagtacctgcagaacaggtatttagagaggccaatggag
attgcacgtatcatagctcgatgcttgtgggaagaagcacgtcttcttcaagttgcgacg
tcagtgtcacaacaagccggacaatcgccacatcacagctctgtggtaactgaaaaacag
cagatcctcgaacacaatctgcaggatgtacggaagagagtacaggatcttgaacacaaa
attaagatactggaaaaccttcaggatgattttgatttcaactacaagaccctgaaaagc
caaggagatgtgcaagatttgaatgggaattcacaagcagcaacaaggcagaagatggct
caactggaacagatgttgaccgctttggatcagatgcggaggcaaatagtaactgaccta
gctgccctactgtctacgatggagtttgtgcagaagaccttgaccgatgaagaactagct
gactggaaaaggcggcaacaagtagcatgcataggaggtccaccaaacatctgccttgac
cgtcttgaaaactggattacatctttagctgagtctcagctccaaacacgtcagcagatt
aagaaactggaagaacttcagcaaaaggtttcttacaaaggtgatcctattgttcaccac
agacctgttttggaggagagaattgttgaattatttcggagcttaattaaaagtgctttt
gtcgtggagagacagccgtgtatgccaatgcatccagaccgtcctttagtgatcaaaaca
ggtgtgcagtttacaacaaaagtgaggttgctcgttaaatttccagagttgaattaccag
cttaaaatcaaggttgccattgataaggattctggagatggttctgcgctgagagggtca
cggaaattcaacatattgggaaccaatacaaaagtcatgaatatggaagaatcaaataat
ggaagcctgtcagcagaatttaaacatttggcttccctcattgtgactgaagagctgcat
ctaataacctttgagacagaagtttatcatcaaggacttaaaattgatttggagacctct
tcactgccagttgtggtaatctccaacatctgccagatgccaaatgcttgggcctcaatc
ctttggtataatatgctaaccaataacccaaagaatgtgaactttttcacaaaaccacca
gttgcgacatgggatcaggtagcagagattctgagttggcagttttcttccactacaaaa
agaggcctgaatatggagcagctagggacactggctgagaagttgcttggtcctggtgtc
aactattctgggtgccagatcacttgggcaaaattctgtaaagagaatatgcctggcaaa
gcattttcattctgggtatggctggacaatatcatagacttagtgaagaaatttattctt
tctctgtggaacgatgggtatatcatgggcttcataagcaaagaaagagagagagcttta
ctgaatgtaaaacccccaggcacattcctccttcgattcagtgagagcaacaaagaagga
ggaatcacgtttacgtgggtggaaaaggatatcaatggaaagacccagatccagtctgtg
gaaccatacaccaaacagcaactaaccaatatgtcttttgctgacattatcataagttac
aagatcatggatgctaccaatatcctcgtgtcaccgctagtgtatttgtaccctgatatt
ccaaaggaagaggcatttggaaaatattgctgcagtgaacctcaagaagctattgatccc
aatgatccagaaacatttgcatacctgaagagaaaattcatttgtgtgacaccaacaaat
tctggcaacacaagtgacctgttcccaatgtctccacgtacactggactctttaatgcat
tgtggaagtaataatgaaggacctgaacaaggagcagcaggtggccttgattccattact
ctggacatggagtttggcacagaatgtgctgcttctccaatgtaa

DBGET integrated database retrieval system