KEGG   Rhincodon typus (whale shark): 109929147Help
Entry
109929147         CDS       T06055                                 

Definition
(RefSeq) sorbitol dehydrogenase-like isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00040  Pentose and glucuronate interconversions
rtp00051  Fructose and mannose metabolism
rtp01100  Metabolic pathways
Module
rtp_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109929147
   00051 Fructose and mannose metabolism
    109929147
Enzymes [BR:rtp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109929147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 109929147
NCBI-ProteinID: XP_020384534
LinkDB All DBs
Position
Unknown
AA seq 356 aa AA seqDB search
MEQHENLSVVLYAKNDLRLEKRPIPEPGPKEVLLKIDSVGICGSDVHYWQTGRIGDFVLK
KPMVLGHEAAGTIFRVGSGVRHLKAGDRVAIEPGIPREIDEHCRNGRYNLSPTIFFSATP
PDDGNLCQYNTHDASYCYKLPESISFEEGALIEPLSVAIHACRRGGVTIGSKVFILGAGP
IGLVNLLVSKSMGASQIVICDLSLKRLEKAKQMGASFTIAVEQTMTPQELGQKVKQTLGG
AMPDISIECTGAELCVQGGVFATKSGGVLVLVGLGKPSANIPILDLLVREVDIRGVFRYC
NTWPVAIDMLASKRINVKPLITHRFPLEEALEAFETTKKGVGIKVILKCDPSNKNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcacgagaatctgtctgtagtgctctatgcaaaaaatgacctgagactggag
aaacgtcccattccagaaccagggcctaaagaggtgctgctgaagatagattccgttggg
atctgtggttcggatgtccattattggcaaactggaaggattggagattttgttctgaag
aagccaatggtcctgggacatgaggctgcagggacgatattcagagtgggttctggagtg
cgacatcttaaagcaggtgatagggtcgccattgagccgggaattcccagagaaattgac
gagcattgccgaaacggacgttacaacctttcgccgacaatcttcttctctgctactcct
cctgatgatgggaacctttgccaatacaatacccatgacgccagctactgttacaagctc
cctgaatccattagctttgaagaaggtgctttgattgaacccctctctgttgcaattcat
gcctgtcgtagaggaggggttacaattggcagcaaagtcttcattttaggggcagggcca
attggactcgtgaatctgctggtttccaagtccatgggagcatctcagattgtgatctgt
gatttatcactgaaaagactggagaaggcaaagcagatgggagccagttttaccattgca
gtcgagcagaccatgactccccaggaactgggtcagaaagtgaagcagactctaggtgga
gctatgcccgatatatctattgaatgcactggagcagagctatgtgtccagggtggtgtc
tttgcaaccaagtctggaggggtgttggtccttgttgggttggggaaaccttcagcaaac
atccccatattagatctgttagtccgagaagtggatatcaggggagttttcagatattgc
aacacgtggcctgtggcaattgatatgttggcttcgaagagaatcaatgtgaaacctttg
atcactcatcgctttcccttggaagaggctcttgaagcgtttgaaaccacaaagaaagga
gtgggaatcaaagtyatattgaaatgtgacccgagcaacaagaacccctga

DBGET integrated database retrieval system