KEGG   Rhincodon typus (whale shark): 109929476
Entry
109929476         CDS       T06055                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04289  lysophosphatidic acid receptor 1
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
rtp04540  Gap junction
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109929476
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109929476
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109929476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109929476
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109929476
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 109929476
NCBI-ProteinID: XP_020384742
LinkDB
Position
Unknown
AA seq 344 aa
MEEYCYYNETIAFFYNNSKKPLAQEWNAISKLVMGLGITVCIFIMLANLLVMIAIYVNRR
FHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANL
LAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIIMGAIPSVGWNCICDINICSTMA
PLYSSSYLVFWAIFNLVTFVVMVVLYAHIFVYVRQRTMRMSRHSSGPRRNRDTMMSLLKT
VAIVLGAFIICWTPGLVLLLLDVFCPDCNVLTYEKFFLLLAEFNSAMNPIIYSYRDKEMS
ATFKQILCCQRNEGSNSAAEGSDRSASSLNHTILSGIHNDHSMV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggaagaatactgctactacaatgaaaccattgcctttttttacaacaacagtaaaaaa
cccctagctcaagaatggaatgcaatcagcaagcttgtcatgggcctgggcatcaccgtg
tgcatctttataatgcttgctaacctgctggttatgatagcaatttatgtgaaccgccgc
ttccattttcccatctattatttgatggcgaatctagcagccgcggacttctttgccggc
ctggcctatttttacctcatgttcaacacgggacccaacacccgcaggttgactgtcagc
acgtggcttctgcgccagggcctaatagacaccagcctcactgcctcggtggcaaacctg
ctggccatcgccatcgagaggcacatcacggtgttccgaatgcagctgcacaccaggatg
agcaaccggcgtgtcgtggtggtgattgttgtgatatggaccatggccatcatcatgggg
gctatccccagcgtggggtggaattgcatctgcgacatcaatatctgctccaccatggca
ccgctctacagcagctcctacttggtcttttgggctattttcaatctggtcaccttcgtt
gttatggtggtcctgtacgcccacatctttgtctacgtgcgacagaggactatgagaatg
tctcgtcacagttcagggccccgcagaaaccgtgacaccatgatgagcctgttgaagacg
gttgctatagtccttggggcgtttatcatctgctggactccgggcctggttttgctgctg
ctggacgtgttctgccctgactgcaacgtcctcacttacgagaagtttttcctgctgctg
gctgaattcaactctgcgatgaaccctatcatctattcctaccgcgacaaggagatgagc
gcaacgttcaagcagatcttgtgttgtcagcgcaacgagggcagcaacagcgcagctgag
ggctcggaccgttcggcttcttccctcaaccacaccatcttgagcgggatacacaatgac
cattcgatggtgtaa

DBGET integrated database retrieval system