KEGG   Rhincodon typus (whale shark): 109929559
Entry
109929559         CDS       T06055                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04012  ErbB signaling pathway
rtp04020  Calcium signaling pathway
rtp04068  FoxO signaling pathway
rtp04510  Focal adhesion
rtp04540  Gap junction
rtp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109929559 (egf)
   04012 ErbB signaling pathway
    109929559 (egf)
   04068 FoxO signaling pathway
    109929559 (egf)
   04020 Calcium signaling pathway
    109929559 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109929559 (egf)
   04540 Gap junction
    109929559 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109929559 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rtp04052]
    109929559 (egf)
Cytokines and growth factors [BR:rtp04052]
 Growth factors
  Growth factors (RTK binding)
   109929559 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 SGL hEGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 109929559
NCBI-ProteinID: XP_020384806
LinkDB
Position
Unknown
AA seq 1032 aa
MLRKPQNYHCSYPDTMEIMPLLPLLIALFSVALTNLSDSVEWRCLDGYRRADDNLTCVAP
SPYLIFSHGNAIFKIDIEGTNHQKLVTHSGISVLLDFHYRNGRIYWVSMEKGLIQRAFIN
GTKRENVRAVGKGLLGFAVDWLHDTIIWTNQRKGTIEMSNLNGKNSKILLKELTFPSVVA
VDPEEGYMFWASEGSVSSIHRATLTGTGVVTIFKTVNKVKSLSLDLIDKRLFWVQSDAGN
ISSSFGSCDYNXGSVYIIKQSMHHQPFGISLFAEYIYYSDWKTSAIRRVNKYTGKDIVTI
SLKPSFLPPADVKVVHPFHQPAAESGSQSPDVNECAFWNHGCTLGCENFPGSYRCYCPEG
FVLLPDMKTCHDPIPCLENYTECSHDCIQTSKGPICVCPPGSILGSDGKTCSGCTAPDNG
GCGQICVLQNPVSWKCECLPGYQLQLDGQHCAASGPRPFLLFANSQDIRRINFDGTDYHI
VLERQMGRVFALDYDPVQNKIYFAHTGLKWIERANLDGSEREELISNDLDLPEGLAVDWI
NRKLYWTDRGLSHIERSELNGMHREVIINEGIDTPRGIIVHPLAKRLFWTDWGDKPRIET
SSLEGDGRLVIVSTNLMWPSGIAIDYLTDKLYWCDTKQSVIEMSDLDGSNRRILAQNEVG
RPFGVAVFEDHVWFTDWSKPSLMRVDKSTGHNRVRLRGGMIRPSSLAVVHPIAKPASRKT
SSHEVNVLIATTLQKEEVSPTQPSSSVTNFNEDEITAELQPRSTLVAEIMVSDQDDCGML
ECDLNAQCFAPEGIGRCQCLEGFTGNGTICSDIDECATDASLCSRHLADCINTEGGYVCK
CHPGYSGDGLLCYGVIGSALPTDDSMEITVRSTTFETPTHKQNNHIATCPLSHQDFCLNG
GVCFHIPEITMFACNCLKGYMGERCEYSDLQWWELHRVEEEKRRNVLIAICVVVLICLLS
VGACVTHCYRHQKHLKKSQYSEEXSDTSSSSINNVTDTSTNNEQQVGHHILIYLHNIVGI
GSNLLILNQLEM
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgcttcgaaaaccacagaattatcactgcagttatccagatactatggagattatgcca
ctgttaccacttttgatagcactcttcagtgttgctttgacaaatctttctgattctgtg
gagtggagatgtttggatggttatcgccgagctgatgataacctcacatgtgttgctcca
tcaccatacctcatcttcagccatggcaatgcaatattcaagattgacatagaaggaact
aaccaccaaaagctcgtgacccattctggaatatcagtcctgttggacttccactacagg
aatggaagaatttattgggtgtctatggagaaagggctgatacaacgggcctttataaat
ggcacaaaaagagagaatgtacgggctgtcgggaaaggtctgttgggatttgctgtggat
tggttgcacgacaccatcatttggaccaatcaaaggaaaggaaccattgaaatgtcaaac
ttaaatggaaagaattccaagatcctgctgaaagaactgacctttccctctgttgtagca
gtcgatccagaagaagggtatatgttttgggcttcagaaggctctgtttcaagtattcat
cgtgcaactctaacaggcacgggggttgtcactattttcaagactgtgaacaaagtgaag
agtttatctctggatcttattgacaaacggctcttctgggttcaaagtgatgctgggaac
atctcgagcagctttgggtcatgtgattacaacrgtggctcagtttacatcataaaacaa
tcaatgcaccaccaaccatttggaatatctctctttgctgagtacatatactactcagat
tggaaaactagtgccattcgtcgagtgaacaaatacactgggaaagatattgtgaccatt
agccttaaaccatcctttttgcctccagccgacgtcaaagtagtgcatccattccaccaa
ccagcagcagaatcaggctcacaatcaccagatgtcaatgaatgtgccttttggaaccat
ggctgcactctaggctgtgagaactttccaggctcttatcgctgctactgcccagaaggc
tttgtactgctgcctgatatgaaaacttgtcatgatcctattccttgtttggaaaattac
accgaatgtagccatgattgcatccagacatccaaaggaccaatctgtgtctgtccacca
ggatctattttaggatctgatggaaaaacatgttcaggttgcactgcgccagataatggt
ggctgtggccagatctgtgtactgcagaatccagtatcttggaaatgtgaatgtctgcct
ggttatcagctacaacttgatgggcagcactgcgctgcctcaggtcccagaccattttta
ttatttgcaaatagccaggacataaggcgcataaactttgatggaacagattaccatatt
gtgctggaaagacaaatgggcagagtctttgcgcttgattatgaccctgtgcaaaataag
atttattttgctcacacaggcctgaagtggattgaaagagctaatctggatggttctgag
cgtgaggaacttattagcaatgatctggatttacctgaaggactagctgtggactggatt
aaccgcaaattatactggactgacagagggttatcacacattgagaggagtgaactcaat
ggcatgcatagagaagtgatcatcaatgaaggtatcgatacgccaagaggaattattgtt
catccattggcaaagagactattctggactgactggggagataaacctagaatagaaacc
tcttctctggaaggtgacggtcgtttggtgatagttagcactaacctcatgtggcccagt
ggaatagccatagactacctaacagacaagctgtactggtgcgatactaaacaatctgtc
attgagatgtcagatctagatggatccaaccgtcggatacttgcacagaacgaagtagga
cgtccctttggtgtggcagtatttgaagatcatgtttggtttacagactggagcaaacct
tcccttatgagagtggataagtcgacgggtcacaatagagtgcgactccgaggtggaatg
atccgaccttcatctttagctgtagttcatccaatagccaaaccagcttccagaaaaaca
tcatcccacgaggtaaatgtgttaatagccacaacattacaaaaggaggaagtgtcaccc
acacaaccgagttcctccgttaccaatttcaatgaggacgagattacagctgagctccag
ccaagatccacgcttgtggcggagataatggtatcagatcaagatgactgtggaatgctg
gaatgtgatctcaatgctcaatgttttgccccagaaggaattggtagatgccagtgtttg
gaaggatttactggcaatggcacaatctgcagtgatattgatgaatgtgccactgatgct
tccctttgcagcagacacctagcagattgtattaacacagagggcggctacgtctgcaaa
tgccatcctggctatagtggtgacgggctcctctgttatggtgtgatcggctcagccttg
cctactgatgactcgatggagataactgtcaggagcactacttttgaaactccgacacac
aagcaaaataatcacattgcgacttgcccgctctcgcatcaggacttctgtctgaatgga
ggggtttgtttccatatccctgagataacaatgtttgcatgcaactgtctgaaaggctac
atgggggaacgatgtgaatacagcgacttacaatggtgggarctgcatcgtgttgaggaa
gagaagagacgtaatgtgcttatagctatatgcgtggtagtgttaatctgtctgctgtct
gtgggagcttgtgttacacactgctacaggcaccagaaacacttgaagaagagccaatac
tctgaagaaatsagtgacaccagcagcagcagcattaacaatgtaactgacacatcgaca
aacaatgagcagcaggttggacaccatattctgatttacttgcataatatagtcgggatt
ggctcaaatcttctgatattaaatcagcttgagatgtga

DBGET integrated database retrieval system