KEGG   Rhincodon typus (whale shark): 109930286Help
Entry
109930286         CDS       T06055                                 

Gene name
lep
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04060  Cytokine-cytokine receptor interaction
rtp04080  Neuroactive ligand-receptor interaction
rtp04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109930286 (lep)
   04060 Cytokine-cytokine receptor interaction
    109930286 (lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109930286 (lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rtp04052]
    109930286 (lep)
Cytokines and growth factors [BR:rtp04052]
 Cytokines
  CSF and other factors
   109930286 (lep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Leptin
Motif
Other DBs
NCBI-GeneID: 109930286
NCBI-ProteinID: XP_020385382
LinkDB All DBs
Position
Unknown
AA seq 228 aa AA seqDB search
MNHTHIVQWNSQYKKDRLNGSRVKSRAVSQSTDSSFFSRFTHRLTNSSPQALRMRNFAMS
TWTILCLLMPLCSGRPTATDRLIRDTRLLARTVISRIQEANNQFKPAPSLVLSGLDLIPE
PLKGNNVENLGTVDEALGCFIESLDTLQMDNTLQIQTDVKNLKVLVRSLATSYGCSISRC
EKAHRLKKFLQKNSAFVFTIRHVILDRLQKYLNRLLRTLDNPKSCRAS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacacgcacattgtgcaatggaactcccaatataagaaggaccggctcaacggg
agcagagtgaaaagtcgggcggtgagccagtcaacagattcatcgttcttctcccgattc
acccatcgtctgaccaattcttcacctcaagctctcaggatgaggaacttcgccatgtcc
acgtggaccattctgtgtttgttgatgccgctgtgctcaggacgtcccaccgccaccgat
agactgatcagagacacccgcctcctggcccggactgtcatcagccgcattcaggaggcc
aacaatcagttcaaaccagcaccaagcctcgttttaagtggattagacctgattccggag
ccgctcaaagggaataacgtggagaacctgggtactgtggatgaggcactaggctgcttc
attgagagtctggacacactccagatggataacactctgcagatccaaactgatgtgaag
aacctcaaagtcctggttagatctttggctacttcatatggctgctccatctctagatgt
gagaaggcacatcgcctgaagaagtttctccagaagaattctgcttttgttttcaccata
agacatgtgattctggacaggctccaaaaatacctcaataggcttctcaggactttggac
aaccccaagagctgcagggcttcttaa

DBGET integrated database retrieval system