KEGG   Rhincodon typus (whale shark): 109931217
Entry
109931217         CDS       T06055                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04012  ErbB signaling pathway
rtp04068  FoxO signaling pathway
rtp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109931217
   04068 FoxO signaling pathway
    109931217
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109931217
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109931217
NCBI-ProteinID: XP_020386132
LinkDB
Position
Unknown
AA seq 201 aa
MSNVRISNGSPSLERMAAQQGGHPKPSACRNLFGPVNHDELNRDLQKKQKEIREQDRRRW
NYDFERDKPLDGNYKWEAVDCKDVPNFYWGSPREQVSSADCSMDVNGNHAIVCVGTLAQG
NSGDTHLANSEQKDVVKETTEHFTDSKEQCCSPRKRAASVDGFPEAKRINTATETDWSAN
SPNINALEKTPKKSISSGHQT
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgcatttctaatggtagcccttcgctggagagaatggcagctcagcaa
ggagggcacccaaaaccttcagcctgcaggaatcttttcggtcccgtaaaccacgacgag
ttgaaccgagacttacaaaagaaacagaaggagatccgcgagcaggacaggcggaggtgg
aattacgacttcgagagggacaagccgctggatgggaattacaaatgggaagccgtggat
tgcaaggatgtgcctaatttttactggggttctcccagggagcaagtgtcatcagccgat
tgcagtatggatgtgaacgggaaccatgcgatagtttgcgtaggaactctggctcaggga
aattcaggggacacacacttagcgaattcagagcaaaaggacgtggttaaagagacaact
gaacatttcacggactcaaaagagcaatgctgtagtccccgaaaacgagctgcgtcagtc
gatggctttccagaagcaaaaagaatcaacacagcgacggagacagactggtcagcaaat
tctcccaatataaatgcattagagaagacgccgaagaaatcgatttcgagcgggcatcaa
acataa

DBGET integrated database retrieval system