KEGG   Rhincodon typus (whale shark): 109932362Help
Entry
109932362         CDS       T06055                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B-like
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00310  Lysine degradation
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109932362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rtp03036]
    109932362
Enzymes [BR:rtp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     109932362
Chromosome and associated proteins [BR:rtp03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109932362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109932362
NCBI-ProteinID: XP_020387180
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MESIRVTARDLCEYDDLATSLVLDPYLGFQTHKMNISNRPVVRRHQYLRDILQKFLKSRD
LETVYRALTLGDWAWHYFLHKTPLEEEIFKAQVFRYLRMFLPESGFEILPCNRYSSESNG
AKIVSLRKWQENDKIELLVGCLAELSEKEESLLRPGENDFSVMYSTRKKCAQLWLGPASF
INHDCRPNCKFVPTEGDRACVKVLRDIEPGDEITCYYGDSFFGENNELCECYTCERRGEG
AFKMKKRAIEMGAFCKYGLRETDSRLSRMKQKGKGRRPKGARVDLYQKTVERALWQTSAR
RLTLSSKRGKRGKWKRRTPSRVHAKSLPVLQSMPLQLQNAQADEVTDVATDAGSVTHLQN
GSQTADQGGETPSQKGEAESLHCGFGYSSTLQLQPSAGQTDPETLVTFQMPEGVFLKDLR
VDLHDCTNLVGPLINLDEAATRKNGRYVWDKPEANPGPVTPQCPEDVSKQKTPANAKWSP
SI
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaatccatacgtgtgacagctagagatctttgcgaatatgatgatcttgccacaagc
ctggttttggatccttacctgggttttcaaacccacaaaatgaacatcagcaatcgacct
gttgtaaggagacaccaatatctcagggacattctacaaaagtttcttaagtcacgagat
ttggagacagtgtatcgggccttgacattgggagactgggcttggcattacttcttgcac
aaaactcctctcgaagaggaaatatttaaagctcaggtattccgctaccttcgaatgttc
ctacctgaaagtggctttgaaattctaccttgtaatcgatactcttcagaatccaatggt
gcgaagattgtgtctttaagaaagtggcaggaaaacgataagatcgagctgttagtcggt
tgcttggcagaactttctgagaaggaggaatccctgctgcgcccaggggagaatgacttc
agtgtgatgtactcgactcggaaaaaatgtgctcagctctggctagggcctgcttcgttc
atcaatcacgactgcagaccgaactgtaagtttgttccgactgaaggtgaccgcgcatgc
gtaaaagttcttcgagacattgaacctggagatgagatcacctgttactatggtgacagt
ttctttggtgaaaacaatgagctgtgcgaatgctacacttgtgaaaggcgaggagaagga
gccttcaagatgaagaagcgtgccattgagatgggcgcattctgcaagtatggactgaga
gagactgacagtcgcctcagtcgtatgaaacagaagggcaaaggacgtcggcccaaggga
gcgcgcgttgatttatatcagaaaacagtggaaagagccttgtggcagacttcagccaga
aggctcaccttaagttcaaagaggggcaaacgtggaaaatggaaaaggcggactccaagt
agggtccacgcaaagtcactgcctgtgcttcagtcaatgcctttgcagctgcagaacgct
caggctgatgaagtgacagacgtggcaaccgatgccggctccgtgactcatttgcagaat
gggagccagacggctgatcagggaggggagactccttcgcagaaaggtgaggcagaaagc
cttcactgtggatttggctattcctcaacattacagcttcagcccagtgctgggcaaact
gaccctgaaacacttgtaacattccagatgccagaaggcgtcttcctgaaggacctgcga
gtggatttgcatgattgcacgaatctggttggaccgttgatcaatctagatgaagcagct
acaagaaaaaacgggaggtatgtgtgggacaagccagaggcaaacccaggtccagttacc
ccccagtgtccagaagacgtgtccaaacagaaaaccccagccaacgccaaatggagtccc
agcatctaa

DBGET integrated database retrieval system