KEGG   Rhincodon typus (whale shark): 109935189
Entry
109935189         CDS       T06055                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00230  Purine metabolism
rtp01100  Metabolic pathways
rtp04020  Calcium signaling pathway
rtp04114  Oocyte meiosis
rtp04261  Adrenergic signaling in cardiomyocytes
rtp04270  Vascular smooth muscle contraction
rtp04371  Apelin signaling pathway
rtp04540  Gap junction
rtp04912  GnRH signaling pathway
rtp04914  Progesterone-mediated oocyte maturation
rtp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109935189 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109935189 (adcy3)
   04020 Calcium signaling pathway
    109935189 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109935189 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109935189 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109935189 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    109935189 (adcy3)
   04916 Melanogenesis
    109935189 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109935189 (adcy3)
   04270 Vascular smooth muscle contraction
    109935189 (adcy3)
Enzymes [BR:rtp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109935189 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4
Other DBs
NCBI-GeneID: 109935189
NCBI-ProteinID: XP_020389449
LinkDB
Position
Unknown
AA seq 1113 aa
MPRNRAFSEPEYSAECSVSLPSDPEQGVERSREVTVRNSGCCLCLPRFMRLTFVPESLEN
LYQTYFRRQRHDTLLVLVVFAALFDCYVIITCTVLYSSDKLASLLVAGIGLAVHLLLFVL
CRFGLVPDKISQKVIPYSLWVLIAAQIFSYLGLNFSHSHEASDTVGWQAFFTFSFFITLP
LQLTPIVLITGTTCGVHTLVLGVTIAQQQQEQINSMALVQQLLANVSIYLCAITVGIMSY
YMADRKHRKAFLETRQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLNDMKKDKESKEL
QQFNTMYMYRHERVSILFADIVGFTQLSSTCSAQELVKLLNELFARFDKLAAKYHQLRIK
ILGDCYYCICGLPDNRDDHAACSIHMGLAMVDAISYVREKTKTEVNMRVGIHSGTVLGGV
LGQKNWQYDVWSTDVTLANKMEAGGIPGRVHISESTCNCLNGEFELEPGEGEKRNEYLRE
KGITTYLVVVAKSAAVKNGINGVKLSLTSSNGNSPLLINTTXCNGSLHTNCTTPDDPEEL
DTRVVNPSFPNPRRRLRLRDISEQVIDAQQNQLELNRLLNAALLERENVQALKGKSTNRL
SMRFIDPELESRFSLEREKQSGAAFSCSCVVLTFTFLVQLLIDPGLLVNYITFIVGEILL
LILTLCSLAAIFSRVFPKKLVFFSTWIDRTRWARNIWAMAAILILTAVDIVDMLSCLHSY
QASSKGNLTQVSRSCVKQPKYYSYISVLALIATTMLVQVSHMVKVFLMFMITGSYGLVSV
LNWREVYDEYDRERFQEFQSLVVPSRFSMVAMIFVMMISLYYFTRHVEKLARTLFLWKLD
VHEQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFS
DFYTEESINNGGIECLRFLNEIISDFDGLLDEPQFRNITKIKTIGSTYMAASGLIPDTVP
SSYNNTVKKDQQESVKERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGMNKGGVLA
GVIGAGKPHYDIWGNTVNVASRMESTGQLGNIQVVEETYLVLKDYGFRFARRGPVYVKGK
GELITYFMKGREKQGSFINSSSVTLPHQVVENA
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgcccaggaaccgtgcattttcagagccagagtactcagcagaatgttcggtcagcctg
ccctctgatcctgagcagggtgtggaacggagccgagaagtgacagtcaggaattcggga
tgttgcctctgcctcccccgtttcatgagactgacttttgtgcccgaatccctggagaac
ctgtaccagacatacttccgccggcaacgacatgatacacttctggttctggtggtcttt
gctgcactatttgactgttacgtcatcatcacatgtacggtgctgtactccagtgacaag
ttagcctctctcctggtggctggaatcggactggctgttcatctcctcctcttcgtcttg
tgtaggtttggacttgtcccggataaaatttcccagaaggtcattccatatagtctctgg
gtcctcatcgccgcccagatcttctcctacctgggcctgaacttctcccactctcatgag
gccagtgacacagtgggctggcaagctttcttcaccttctccttcttcatcacccttcca
ctgcagctgacacccattgtcctcatcaccggcaccacatgtggggttcacacccttgtt
ctgggggtcaccatcgcccagcaacaacaggagcagatcaacagtatggccttggtgcag
cagctattagctaacgtcagtatctacctctgtgccatcactgtggggatcatgtcttac
tacatggcagatcgcaaacatcgcaaagcatttctggagacacgacaatctctggaggtt
aaactcaacctggaggaacagagccaacagcaggaacgtctccttctgtctattctacca
aagcacattgcagatgagatgttaaacgacatgaaaaaggacaaagagtcaaaggagcta
cagcaattcaacaccatgtacatgtaccgacatgagagagtcagcatcctgtttgcagat
attgttggattcactcagttgtcatccacctgcagtgcacaggagctggtcaaacttctc
aatgaactcttcgctcgctttgataaactggcagcgaaataccatcagctacggatcaag
atcctgggtgattgttactactgtatctgtggcttaccagacaatcgtgatgatcatgct
gcatgctccattcatatgggcttggctatggtcgacgccatctcgtacgttcgtgaaaag
acaaaaacagaggtgaatatgcgggttggcattcacagtggcactgtcctcggtggtgtc
ctggggcagaagaactggcaatatgatgtctggtctacagatgtcacactggcaaacaag
atggaggctggtggcatccctgggagagtgcacatttcagaaagcacctgtaattgcctg
aatggagagtttgagcttgaaccaggagaaggggagaagagaaatgagtatttgcgggag
aaggggatcacgacatacctggtggtggtggcaaagtctgcggctgtcaagaatgggatc
aatggcgtgaagttgtctctcacatcatccaatggaaactcaccactgttgatcaacacc
acagamtgtaatggcagtctccataccaactgcaccacccctgatgacccagaggaactc
gatacacgggtggttaacccttcatttccaaaccctcggaggcgcctgcgattgcgtgat
atatcggagcaggtgattgatgctcaacagaaccagctggagctgaatcgtttattgaat
gcagctttgttagagcgagagaatgtgcaggcgttgaaagggaaatccacaaaccgtctc
tcgatgcgattcattgaccctgagctggagagccgcttctcactggagagggagaaacag
agtggagcagctttcagctgttcctgtgtcgtcctcaccttcaccttcttggtgcagctt
ctcattgaccccggattgctagtgaattacatcacgttcattgtgggggagattctactc
ttgatcctcaccttatgttccctggctgccatcttctccagggtcttccccaagaaactg
gttttcttctcaacgtggattgaccggacgcgatgggccaggaacatctgggcaatggct
gctattctaatcctcactgccgtagatattgtagacatgttgagctgtctgcatagttac
caagcttcgtcaaaaggcaacctgacccaggtcagcaggagctgtgtgaaacaaccaaaa
tactacagctacatctctgtgttggcacttattgccacaaccatgttggtgcaggtcagc
cacatggtgaaggtgttcctgatgttcatgatcactgggagctatggcttggtcagtgtc
ctaaactggcgagaggtctatgacgagtatgaccgagaacgttttcaggaatttcaatca
cttgtggtgccatctcggttttccatggtagccatgatcttcgtcatgatgataagtctt
tactatttcactcgacatgtggaaaagttggcacggacactgttcctgtggaagcttgat
gtccatgagcagaaggaacgagtttacgagatgcggcgatggaatgaagcgcttgtcacc
aatatgttaccggaacatgttgctcggcatttccttggttccaagaagagagatgaggaa
ttgtatagtcagtcgtatgatgagattggggtcatgtttgcatcaatccccaatttctct
gacttctacactgaggagagtattaacaatggaggcatcgagtgtctgcgattcctcaat
gaaatcatctcggattttgatggcttattggatgaaccccagttccgaaacatcaccaaa
atcaagaccatcggtagtacctacatggcagcatcaggcttaataccagacactgttccc
agcagttacaataatactgtcaaaaaggatcaacaagaatcagtgaaggaacgctggcag
cacctagcagatctggcagactttgcattggccatgaaagtcactttaatgaacatcaat
tatcaatcatttaacaacttcatgctacgcatcggtatgaataaaggaggggttcttgcg
ggagtgattggtgcaggaaaaccacattatgatatctgggggaatacggttaatgttgcc
agcagaatggagtcaacaggacagctggggaatatccaggtcgtcgaggagacatacctg
gtgctgaaagattacggattccgttttgcacggcgtggtcctgtctatgtcaagggcaaa
ggcgagctcatcacctatttcatgaaaggtcgagagaagcaaggctccttcatcaacagc
tcatctgtcactctgcctcatcaggtggtggagaatgcatga

DBGET integrated database retrieval system