KEGG   Rhincodon typus (whale shark): 109935524Help
Entry
109935524         CDS       T06055                                 

Gene name
ogt
Definition
(RefSeq) UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    109935524 (ogt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rtp01003]
    109935524 (ogt)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rtp03036]
    109935524 (ogt)
Enzymes [BR:rtp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     109935524 (ogt)
Glycosyltransferases [BR:rtp01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   109935524 (ogt)
Chromosome and associated proteins [BR:rtp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     109935524 (ogt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_17 TPR_12 TPR_14 TPR_16 TPR_19 TPR_7 TPR_10 TPR_9 TPR_6 NARP1 TPR_MalT TPR_15 FAT MIT TPR_21 Wzy_C_2 SNAP EST1_DNA_bind BTAD ANAPC3 Fis1_TPR_C Tcf25
Motif
Other DBs
NCBI-GeneID: 109935524
NCBI-ProteinID: XP_020389753
LinkDB All DBs
Position
Unknown
AA seq 1038 aa AA seqDB search
MAASVGGVTDSTGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRR
LDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLA
AALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNF
AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLR
ALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVA
EAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASV
LQQQGKLQDALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD
AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLV
SIVADQLEKNRLPSVHPHHSMLYPLSHTFRKAIAERHGNLCLDKINVLHKPPYEHPKDLK
ASNGRLKIGFVSSDFGNHPTSHLMQSIPGMHNSEKFEVFCYALSSDDGTNFRVKVVAEAN
HFVDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSG
APFMDYIITDKETSPLDLAEQYSEKLAYMPNTFFIGDHANMFPHLKKKAVIDFKSNGHIY
DNRIVLNGIDLKAFLDSLPDVKVVKLKCPDGGDNSDTNSALSMPVVPMNAAAEAIINMIN
QGQIQVTINNFTVSNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDSIVYCNFNQLY
KIDPNTLQMWASILKRVPNSVLWLLRFPAVGEPNIQQYAQSMGLSANRIIFSPVAPKEEH
VRRGQMADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLMCLGCPELIAK
TRQEYEDIAVLLGTDMEYLKKIRGKVWKQRVSSPLFNTKQYTMDLERLYTQMWEHYAAGN
KPDHLIKPLKAMETNETA
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcggttgggggtgtaacagacagcacagggttagcagaactggcacatcgt
gaatatcaagcaggagattttgaggcagctgagaggcactgcatgcaactttggagacaa
gaacctgataacactggtgttcttttgcttctctcctccatacatttccagtgtcgcaga
ttggacaggtctgctcacttcagcactctggctatcaaacagaaccccatgttggctgag
gcctattcaaacttgggaaatgtctataaagagcgtggacaacttcaggaggctatcgaa
cattatcgacatgctcttcggctcaaaccagactttatagatggatacatcaacttggca
gcagcactagttgcagcaggagacatggagggtgcagtgcaagcctacgtatctgcccta
cagtacaatcctgatttgtattgtgttcgcagtgacctggggaacctccttaaagccctg
ggtcgcttagaagaagccaaggcttgttacctgaaagcgattgagactcagccaaacttc
gctgttgcctggagcaaccttggatgtgtgttcaatgcccaaggagagatttggctggct
attcaccactttgaaaaggctgttaccttggatcctaatttcttggatgcttacatcaac
ttgggaaatgtgctgaaggaggctcgcatttttgacagggctgtggcagcatatctgcga
gcattaagtctaagtcctaatcatgcagttgttcatggaaacctggcttgtgtttattat
gaacaaggattgattgatctggctatagacacatacagaagagccattgaactgcagcct
cactttccagatgcctactgcaacctggctaatgcactgaaggagaaaggaaatgttgct
gaagcagaggaatgctacaatacggcactacgactctgtcccacgcatgccgactctctc
aacaacttagctaatatcaaaagggagcaagggaacattgaagaggctgtacgactgtat
cggaaagctcttgaggtgtttccagaatttgcagctgcccattcaaacttggccagtgtg
ttgcagcagcagggaaaattgcaggacgcattaatgcattataaggaggctattcgaatt
agtccaacctttgccgatgcctactcaaacatgggaaacacactcaaagaaatgcaagat
gtgcagggtgccttgcagtgctatacaagagcaattcagatcaatcctgcttttgctgat
gctcacagcaacttagcatcgatccataaggattctggaaatattccagaagccattgct
tcctacagaactgccctgaagctaaagcctgacttcccagatgcttactgtaatctggca
cactgtttgcagattgtatgtgactggacagattatgatgagcgaatgaaaaaattggtc
agtatagtagctgaccaactggagaaaaatcggctgccatctgtgcatccacatcacagt
atgctgtatccactgtcccatacctttcgcaaagccattgcggaacgtcatggaaatctg
tgtcttgacaagattaatgtgcttcacaagccaccatatgaacatccaaaagacttgaaa
gctagtaatggacgtctgaaaattggttttgtgagttcagattttgggaaccatcccacc
tctcatctgatgcaatcaatccctgggatgcacaactcagaaaaatttgaggttttttgt
tatgcattgagctctgatgatggcactaattttcgagtgaaagtggtcgctgaagcgaat
cattttgtggacctatcccagatcccatgcaacggcaaagccgctgatcgtattcatcag
gatggaattcacattcttgttaatatgaacggatacacaaaaggagcacggaatgaactg
tttgctcttcgtccagctcctatacaggcaatgtggttaggttatcctggaacaagtgga
gccccattcatggattatattataactgacaaggaaacttcaccgcttgacctggcagag
caatactctgaaaagctggcctacatgcccaatactttctttattggagatcatgccaac
atgttcccacatttaaagaaaaaggctgtgattgacttcaagtcaaatggacacatttac
gataatagaattgttctgaatggtattgatctgaaagcattcctagacagcctgcctgat
gtcaaagtagtgaagctgaaatgtcctgatggtggagacaactcggataccaactctgca
ctttcaatgcctgttgtcccaatgaatgctgcagctgaagcaattatcaacatgatcaac
caaggacaaatccaggtcacaatcaacaacttcacagtcagcaatgggctggcaacaaca
caaatcaacaacaaagcagcaactggcgaggaggtaccacgcacaatcattgttaccaca
cggtcacaatatgggttgccagaagattctattgtttattgcaactttaaccagctgtat
aagattgatccaaatactctgcaaatgtgggccagtatcctaaaacgagttcctaatagt
gtgctgtggctacttcgattccctgctgtgggagagcccaatattcaacagtatgcccag
agcatgggactgtctgccaaccgcattatattttcacctgtcgccccaaaggaggaacat
gtaaggcggggacagatggctgatgtctgtttagacactccactctgtaatggacacact
acaggaatggatgtactctgggcagggacgccaatggtgactatgccaggtgaaacactt
gcatctcgtgttgctgcttcacagctgatgtgtttgggatgtccagaactgattgcaaag
accagacaagagtatgaggatattgctgttctgttgggaacagatatggaatatctgaag
aaaatcagaggaaaggtgtggaaacagagagtaagcagccccctgttcaacaccaaacag
tatactatggatctggagcgcctctacacacagatgtgggagcattatgctgcaggcaac
aaaccagaccatttgattaagccacttaaagccatggagacaaatgaaactgcttaa

DBGET integrated database retrieval system