KEGG   Rhincodon typus (whale shark): 109937909
Entry
109937909         CDS       T06055                                 

Gene name
lpar6
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109937909 (lpar6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109937909 (lpar6)
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109937909 (lpar6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Other DBs
NCBI-GeneID: 109937909
NCBI-ProteinID: XP_020392000
LinkDB
Position
Unknown
AA seq 336 aa
MAESNFTCIPDDSFKYTLYSSVYSMVFIIGLVSNCVALYVLRCSLQLRNETITYMTNLAV
SDLLFVFTLPFRIFYYVTRDWPFGDLLCKVSGTLFLTNMYGSILFLTCISVDRFLAIVHP
FRSRMLRTKKNAIVVCVAVWLTVLTGSIPATFLRTTNDRANQTKTCFENFSSHTWKNFLS
KIVIFIEIVGFFIPLLLNFFCFSMMLKTLKQPITLSRSKLNKKKILRMIVVHFLIFVTCF
VPYNITLVMYSLVRTGTVGNCSVVTVVKTMYPITLCFAVSNCCFDPIVYYFTSETFKNSI
KRKSKSLRLDSDFSEAFLSSTVRTLKSKMLNSESTV
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggcagaatcaaactttacgtgtattcctgacgactccttcaagtatacattgtacagc
agtgtgtacagtatggtgtttataatcggcctcgtgtcaaattgtgtggctctgtacgtt
ttgaggtgttccttacaactccgaaacgaaacaataacctacatgaccaacctggcagtg
tcagacttgctgtttgtcttcacgctaccctttcggatattttattatgtgaccagagac
tggccctttggagacttgctgtgcaaggtttcaggaacgctgtttctcaccaacatgtat
gggagcatccttttcctgacctgcatcagcgtggatcggttcctggctatcgttcaccct
tttcggtcaaggatgctgaggacgaaaaaaaacgccatcgttgtgtgtgtggccgtgtgg
ctgacagtgctcaccggaagtataccagcaacctttttacgaaccactaacgacagagcc
aatcaaaccaaaacgtgcttcgaaaacttctccagccacacttggaaaaactttctgtcg
aaaattgtcattttcattgagatcgtgggtttctttattcctctgctgctgaacttcttc
tgtttctcaatgatgctaaagactttaaaacaacctattactctttcccgaagcaagtta
aacaagaaaaaaattctccgcatgattgtggtccatttcctcattttcgtcacctgcttc
gtaccctacaatataactctggtgatgtattcactggtaaggacaggaacagtaggaaac
tgctctgtagtgaccgtagttaaaacaatgtaccccatcacgctgtgctttgccgtatcc
aactgttgttttgacccgattgtttattacttcacttcagaaacctttaagaattccatc
aagaggaagtccaagtcgctaaggcttgactcggacttttctgaggccttcctcagcagt
acagtaagaacactgaaatccaaaatgctcaattcagagtcgactgtttaa

DBGET integrated database retrieval system