KEGG   Rhizobium tropici: RTCIAT899_CH07310Help
Entry
RTCIAT899_CH07310 CDS       T02432                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rtr  Rhizobium tropici
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rtr03012]
    RTCIAT899_CH07310
   03029 Mitochondrial biogenesis [BR:rtr03029]
    RTCIAT899_CH07310
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtr04147]
    RTCIAT899_CH07310
Translation factors [BR:rtr03012]
 Eukaryotic Type
  Elongation factors
   RTCIAT899_CH07310
 Prokaryotic Type
   RTCIAT899_CH07310
Mitochondrial biogenesis [BR:rtr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RTCIAT899_CH07310
Exosome [BR:rtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RTCIAT899_CH07310
  Exosomal proteins of breast cancer cells
   RTCIAT899_CH07310
  Exosomal proteins of colorectal cancer cells
   RTCIAT899_CH07310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AGB70862
UniProt: L0LHZ5
LinkDB All DBs
Position
1497604..1498779
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAQVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaataagccgcacgttaacatcggtacgatcggtcac
gttgaccacggcaagacgtccttgacggcagcgatcacgaagtacttcggcgagttcaag
gcgtacgaccagatcgacgcggctccggaagagaaggctcgtggtatcacgatctcgacg
gcccacgttgaatacgagacgccgaaccgtcactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcacgggtgccgcacagatggacggcgcgatcctggtt
tgctctgccgccgacggcccgatgccgcagacgcgcgagcacatcctgcttgctcgccag
gttggcgttccggcgatcgtggtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagctcgaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgatatcccggtcgtcaagggttcggcgcttgcagcccttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggctcaggtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggccgcgtcgagcgcggtatcgtcaaggttggtgaagaagtc
gaaatcgtgggcatccgtccgacgtcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctggaccagggccaggccggcgacaacatcggcgcactggttcgcggtgttaac
cgtgacggcgtcgagcgtggtcagatcctgtgcaagccgggttcggtgaagccgcacaag
aagttcatggctgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgtacgactgacgtgaccggcatcgtgacg
cttccggaaggcacggaaatggttatgcctggcgacaacgtcacggttgccgttgagctg
atcgttccgatcgcgatggaagaaaagcttcgcttcgcaatccgcgaaggcggccgtacc
gtcggcgccggcatcgtggctagcatcgtcgagtaa

DBGET integrated database retrieval system