KEGG   Rhizobium tropici: RTCIAT899_CH09380Help
Entry
RTCIAT899_CH09380 CDS       T02432                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
rtr  Rhizobium tropici
Pathway
rtr00340  Histidine metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    RTCIAT899_CH09380 (hisI)
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     RTCIAT899_CH09380 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AGB71262
UniProt: L0LJ37
LinkDB All DBs
Position
1894139..1894588
Genome map
AA seq 149 aa AA seqDB search
MNLIFNAPSEDKSELEDAGDFTPRFDDRGLITAIVTDAQDGELLMVAHMNAEALALTIKT
GTAHYFSRSRGKIWKKGETSGNLQSVKEIRTDCDQDAIWLKVEVAGHDATCHTGRRSCFY
RTVELENGKPVLSVTDDHLHFNPEEVYKQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgattttcaatgcaccttccgaagataaatccgaactcgaagatgccggcgat
ttcacccctcgcttcgacgaccgcggcctgatcaccgcgatcgtgaccgatgcgcaggat
ggcgagctgctgatggttgcgcatatgaatgccgaagcgctcgccctgacgatcaagaca
ggcacggcgcattattttagccgttcacgcggtaaaatctggaaaaagggcgaaacctcc
ggaaacctgcaatcggtcaaggagatccgcacggattgcgatcaggatgcaatctggctg
aaagtggaggtggccggacatgacgcgacatgccatactggccgtcgttcctgcttctac
cgaacggtcgagcttgaaaatggcaagccggtgctgagcgtgaccgacgatcacctgcat
ttcaatccggaagaagtttacaagcagtag

DBGET integrated database retrieval system