KEGG   Rhizobium tropici: RTCIAT899_CH09505Help
Entry
RTCIAT899_CH09505 CDS       T02432                                 

Definition
(GenBank) helix-turn-helix domain-containing protein
Organism
rtr  Rhizobium tropici
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_25 HTH_26 Spc7 Phage_CI_repr
Motif
Other DBs
NCBI-ProteinID: AGB71286
UniProt: L0LKP5
LinkDB All DBs
Position
complement(1913740..1914213)
Genome map
AA seq 157 aa AA seqDB search
MTARHKIAGATRKGIAPMFKPEQETTVFSDEGGDTLGGRLSMARDAAGISLETLAGQLGV
SEETMLAWESDRAEPNPSALAKMSALFDVSPAWLMTGSGDGPGEDSDERALEAVRNELSR
LRTAYQEVGRLIETTTKQLERLDHQIRLRNLSKDVAH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcggcacaaaattgccggcgcgaccaggaaagggatcgcaccgatgttcaaa
ccagaacaagagacgaccgttttttcggatgaaggcggcgacacgcttggcggacgcctg
tccatggctcgcgatgccgcgggaatcagcctcgaaacgctggccggacagcttggcgtc
agcgaggagacaatgcttgcgtgggaatcagatcgcgccgaacccaatccctccgcgctg
gccaagatgtcggctcttttcgatgtttcaccggcatggttgatgaccggatcgggtgac
ggacccggagaggatagcgatgagcgcgccctggaagccgtcaggaacgagctatcgcgg
ctgcgcaccgcctatcaggaggtcggtcggctgatagagacgacaacaaagcagctcgaa
cgcctcgaccatcagatcaggctgcgcaatctgagcaaggatgtggcgcattga

DBGET integrated database retrieval system