KEGG   Rhizobium tropici: RTCIAT899_CH13010Help
Entry
RTCIAT899_CH13010 CDS       T02432                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rtr  Rhizobium tropici
Pathway
rtr00240  Pyrimidine metabolism
rtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RTCIAT899_CH13010 (tdk)
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RTCIAT899_CH13010 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AGB71981
UniProt: L0LMN9
LinkDB All DBs
Position
complement(2614816..2615397)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYSTMNAGKSTMLLQAAYNYQERGMRTAAFIAALDDRAGRGTIASRIGLTMDAL
PFETNDDLYAMVDEMHASEPLACVFVDEAQFLTREQVWQLAHIVDRLGLPVMAYGLRTDF
HGHLFPGSQELLTIADELREVRTICHCGRKATMVVRLDAAGNVVREGAQIEIGGSDKYVS
LCRRHWEEAITCE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttccattattcgacgatgaatgccggcaaatcgaccatgctgctg
caggctgcctataattatcaggagcgcggcatgcgcacggcggctttcatcgcggctctc
gacgatcgtgccggccgcggcaccatcgcctcgcgcatcggactgacgatggatgccttg
ccgttcgaaaccaacgacgatctctatgcgatggtcgatgaaatgcatgcaagcgaaccg
ctcgcatgcgtcttcgtcgacgaggcgcaatttctgacgcgcgagcaggtctggcagctt
gcccatatcgtcgaccgcctcggccttccggtcatggcttatgggctgcgcacggatttc
catggacatctgtttccgggatcgcaggagctgctgaccatcgccgacgaattgcgggag
gtgcgcaccatctgccattgcgggcgcaaggcgacgatggtggtgcgcttggacgctgcc
ggcaatgtcgtgcgcgaaggcgcgcagatcgagatcggcggcagcgacaaatatgtttcg
ctttgccgtcgccactgggaggaggcgattacttgcgagtga

DBGET integrated database retrieval system