KEGG   Rhizobium tropici: RTCIAT899_CH16680Help
Entry
RTCIAT899_CH16680 CDS       T02432                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rtr  Rhizobium tropici
Pathway
rtr00564  Glycerophospholipid metabolism
rtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RTCIAT899_CH16680
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RTCIAT899_CH16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 Pyr_redox STPPase_N GIDA
Motif
Other DBs
NCBI-ProteinID: AGB72699
UniProt: L0LRD9
LinkDB All DBs
Position
3375514..3377025
Genome map
AA seq 503 aa AA seqDB search
MSEQVYDIFVIGGGINGCGIARDATGRGYKVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREVLWAMAPHIIWPMRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTATLDMKKDPAGKPLKALFTKAFEYSDGWVDDARMVVLNARDAADRGATIMPRTKVVS
AGREGAVWAIETENTISGEKRQFRARMLVNAAGPWVDQVLSGTFGKNQVHNVRLVQGSHI
VVRKKFDDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYKDDPKDVKITEGETTYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKVEGEEGQAPLLNVFGGK
LTTYRRLGEHALEKIGEAIGLKGKPWTAGSSLPGGDFPVRGYEAEVTKLKSRYPFLADPH
ARRLIRRYGTRAAMILGSAKTIADLGRCFGSDLYEAEVRYLIEQEWAYSATDILWRRSKK
GLYLSKEEAAALDSYMAESHVHA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaggtctacgacattttcgttatcggcggcggcatcaatggctgcggcatc
gcccgcgacgccaccggacgcggctacaaggtcgcgcttgccgagatgaacgacttcgcc
tccggaacgtcgtcaggcgccacaaagctcattcatggcggcctgcgctacctcgaacat
tacgaattccgtctcgtgcgcgaatcgctgatggagcgcgaagtgctctgggccatggcg
ccgcacatcatctggccgatgcgtttcgtcctgccttaccataagggcggcatccgtccg
gcttggctgatccgcctcggccttttcctctacgatcacctcggcggacgaaagctgctg
cccccgaccgcgacgctggacatgaagaaggatcctgcgggcaagccgctgaaggcgctc
ttcaccaaggctttcgaatattccgacggctgggtcgacgatgcccgcatggtcgtattg
aatgcccgcgatgcggccgaccgcggtgcgacgatcatgccgcgtacgaaggtggtctcc
gccgggcgcgaaggcgcggtctgggcgatcgaaacggaaaatacgatcagcggcgagaag
cgtcagtttcgcgcccgcatgctggtcaatgcagcaggtccctgggtcgatcaggtcctg
tccggtacgttcggcaagaaccaggtgcacaatgtccgtctcgttcagggcagccatatc
gtcgtgcgcaagaagttcgacgatccccgcgcctatttcttccagaacccggacaaccgc
atcatcttcgccattccctacgagcaggatttcacgctgatcggcaccacggatcgcgac
tacaaggacgacccgaaggatgtgaagatcaccgagggggaaaccacctatctctgcaat
gccgccagcgaatatttcaaggagcctgtccggcccgaagatatcgtctggacctattcg
gccgtgcgcccgctctacgacgatggcgcatcgaaagcgcaggaagccacgcgcgactac
gttctcaaggtcgagggagaagaaggccaggcgccgctgctcaacgtcttcggcggcaag
cttaccacctatcgccgccttggcgaacatgcgctggaaaagatcggcgaagccatcggc
ctcaagggtaaaccctggactgccggcagttcgctgcccggcggcgattttccagttcgc
ggctatgaggccgaagtcaccaagctcaagtcccgctatcccttccttgccgacccgcat
gcccgccggctcatccgccgctacggcacgcgcgctgccatgatcctgggcagcgccaag
acgatcgccgatctcggccggtgtttcggaagcgatctctatgaggcggaagtacgatat
ctgatcgaacaggaatgggcctatagcgcaacagatatcctatggcgccgttccaagaag
ggcctctacctctcgaaggaagaagccgcagctctcgacagctatatggcagagagccac
gtccacgcctag

DBGET integrated database retrieval system