KEGG   Rhizobium tropici: RTCIAT899_CH16865Help
Entry
RTCIAT899_CH16865 CDS       T02432                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rtr  Rhizobium tropici
Pathway
rtr00020  Citrate cycle (TCA cycle)
rtr00190  Oxidative phosphorylation
rtr00650  Butanoate metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
Module
rtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rtr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_CH16865 (sdhB)
   00650 Butanoate metabolism
    RTCIAT899_CH16865 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RTCIAT899_CH16865 (sdhB)
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RTCIAT899_CH16865 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     RTCIAT899_CH16865 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: AGB72736
UniProt: L0LPT6
LinkDB All DBs
Position
complement(3418821..3419600)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSQMREGKVWPKPVGAKNTREFRVYRWSPDDGQNPSIDTYYIDIDDCGPMVL
DGLLYIKNNIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGLDEIKGTVKVYPLPHMP
VVKDLVPDLTNFYAQHRSIEPWLKTVSPPPAKEWKQSHEDRLKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgctctccccaagaactctcagatgcgcgaaggcaaggtctggccgaag
ccggtcggcgccaagaacacgcgcgaattccgcgtctatcgctggagcccggatgacggc
cagaacccgagcatcgatacctactatatcgatatcgacgattgcggcccgatggtgctc
gatggcctgctctacatcaagaacaacatcgacccgacgctgaccctgcgccgctcctgc
cgcgaaggcatttgcggctcctgcgcgatgaacatcgacggcaccaacacgctcgcctgc
accaagggtctggacgagatcaagggcacggtgaaggtctatccgctgccgcacatgccc
gtcgtcaaggacctcgtgccggatctgacgaatttttatgcccagcaccgctcgatcgaa
ccttggctgaagacggtatcgccgccgccggctaaggaatggaagcagagccatgaggac
cgcctgaagctcgacggcctctacgagtgcattctgtgcgcctgctgctcgacctcctgt
ccgagctattggtggaacggcgaccgttacctcggtccggccgttctgctacaggcctat
cgttggctgatcgattccagagacgaagccaagggcgagcgtctcgacaatctcgaggat
ccgttccgcctctatcgctgccatacgatcatgaactgcgcccagacctgcccgaagggt
ctgaatccggccaaggcgatcgccgaaatcaagaagatgatggtcgagcggcgggtctga

DBGET integrated database retrieval system