KEGG   Rhizobium tropici: RTCIAT899_CH16870Help
Entry
RTCIAT899_CH16870 CDS       T02432                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rtr  Rhizobium tropici
Pathway
rtr00020  Citrate cycle (TCA cycle)
rtr00190  Oxidative phosphorylation
rtr00650  Butanoate metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01130  Biosynthesis of antibiotics
rtr01200  Carbon metabolism
Module
rtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rtr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_CH16870 (sdhA)
   00650 Butanoate metabolism
    RTCIAT899_CH16870 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RTCIAT899_CH16870 (sdhA)
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RTCIAT899_CH16870 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RTCIAT899_CH16870 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGB72737
UniProt: L0LNA8
LinkDB All DBs
Position
complement(3419618..3421474)
Genome map
AA seq 618 aa AA seqDB search
MAPNSSAQNGAAQNGKAYKYIDHSYDVIVVGAGGAGLRATLGMAEQGFRTACITKVFPTR
SHTVAAQGGIAASLQNMTPDSWQWHLYDTVKGSDWLGDVDAMQYMVMEAPKAVYELEHYG
VPFSRNEEGKIYQRPFGGHMQNFGEGPPVQRTCAAADRTGHAILHTLYGQSLRNNAEFFI
EYFALDLIMSDDGSRCTGVVAWCLDDGTIHRFAAKMVVLATGGYGRAYFSATSAHTCTGD
GGGMVARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNSEGERFMERYAPSAK
DLASRDVVSRCMTLEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESARIFAGVDV
TRDPIPVLPTVHYNMGGIPTNYWGEVLNADSNNPERVLPGLMAVGEAGCASVHGANRLGS
NSLIDLVVFGRAAAIRAGQVIDRVGPVPPVNVAACDKIMERFDRLRHASGSTPTAALREK
MQRAMQEDAAVFRTQESLESGCRRLSEIWGEMSDIKVTDRSLIWNSDLVETLELHNLMAN
AITTIYGAEARKESRGSHAREDYTEGKFAGRDDENWRKHTLAWVNEAGDVKLDYRPVHTD
LIAEGIDPHKIEPKARVY
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaactcatccgctcagaatggggctgcccagaacgggaaagcctacaaatat
atcgatcactcctatgacgtgatcgtcgtcggcgccggcggcgccgggctgcgcgccacg
ctcggcatggccgagcagggcttccgcaccgcctgcatcaccaaggtcttcccgacgcgc
tcgcataccgtcgcggcccagggcggcattgccgcctcgctgcagaacatgacgccggac
agctggcagtggcatctctacgacaccgtcaagggctccgactggctcggcgacgtcgac
gcgatgcagtacatggtcatggaggcgccgaaggccgtttacgagcttgagcattacggc
gtgcctttctcgcgcaacgaagaaggcaagatctaccagcgcccgttcggcggccacatg
cagaatttcggcgagggaccgccggtgcagcgcacctgcgcggccgccgaccgtaccggc
cacgccatcctgcacacgctctatggccagtcgctgcgcaacaatgcggaattcttcatc
gaatatttcgcgctcgacctcatcatgtccgacgatggcagccgctgcaccggcgtcgtc
gcctggtgcctggatgacggcacgatccatcgcttcgccgccaagatggtggtgctggcg
accggcggttacggccgcgcctatttctcggcaacgtctgcccatacctgcaccggcgac
ggcggcggcatggtggcccgcgccggcctgccgctgcaggacatggagttcgtgcagttc
catccgaccggcatctacggttcgggctgcctcatcaccgaaggcgcgcgcggcgaaggc
ggttatctggtcaattccgagggcgagcgcttcatggagcgctatgctccttcggcgaag
gaccttgcctcgcgtgacgtcgtttcacgttgcatgacgcttgagatccgtgagggtcgc
ggcgtcggcaagaacaaggatcacatcttcctgcatctcgaccatctcgatccggccgtg
ctgcatgagcgcctcccgggcatttccgagagcgcccgcatcttcgccggcgttgatgtg
acccgtgacccgatccccgtcctgccgaccgttcactacaacatgggcggcattccgacg
aactattggggcgaagtgctgaatgccgacagcaacaatcccgagcgcgtgctgccgggc
ctgatggctgtcggtgaagctggctgcgcttcggtgcatggcgccaatcgcctcggctcc
aactcgctgatcgaccttgtggtcttcggccgcgccgccgccatccgcgccggccaggtc
atcgaccgcgtcggcccggttcctccggtcaatgtcgcggcctgcgacaagatcatggaa
cgcttcgatcgcttgcgtcacgccagcggctcgacgccgacggcagcattgcgcgaaaag
atgcagcgcgccatgcaggaagatgcggccgtgttccgcacccaggaatcgctggaatcc
ggctgccgccgtctttcggaaatctggggtgaaatgtctgacatcaaggtcaccgaccgt
tcgctgatctggaattccgacctcgtcgaaacgcttgaactccacaatctgatggccaac
gccatcacgacgatctacggcgccgaggcgcgcaaggaaagccgcggctcgcatgctcgc
gaagactataccgagggcaagttcgccggccgcgacgacgaaaactggcgcaagcatacg
cttgcctgggtcaacgaggcaggcgacgtgaagctggactatcgtccggttcacaccgac
ctgatcgccgaaggcatcgatccgcacaagatcgagccgaaggctcgcgtgtactga

DBGET integrated database retrieval system