KEGG   Rhizobium tropici: RTCIAT899_PC04025Help
Entry
RTCIAT899_PC04025 CDS       T02432                                 

Definition
(GenBank) putative dehydrogenase
Organism
rtr  Rhizobium tropici
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGB74602
UniProt: L0LTQ6
LinkDB All DBs
Position
pRtrCIAT899c:856503..857513
Genome map
AA seq 336 aa AA seqDB search
MRAVRLEAIGDMTMRMVEKPSAGPGEIIVRVLAAGICGSDRHMYKGEYPTAIPVTLGHEF
CGLVEEVGEGVSSFVGGELVTVDPNIACGTCPACRRGRPNLCANLTAIGVTRDGGFADYV
AVPCSQAFTLPPDLDPVHGAFCEPLACCIHAIDKAQIRPGDSVAILGGGVIGLLMVQLAR
LAGADQIILVTRQLSRREAALRLGATLALDPTAIDAVAAVKDATHGGVDVVIECAGVPET
LQSGVRMARRGGAFVLFGVTPAGLEVPVLPFDLLVNEVEIRPAYLNPFTHARAAAMVAGG
ILELDSLVTKTIGLEDVAGVVGSAPLAGEIKVIVRP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagtccgtttggaagcgatcggcgatatgaccatgcgtatggtcgagaagccg
agcgccgggccgggagagatcatcgtccgggttcttgccgccggcatctgtgggtccgac
cggcacatgtacaagggcgaatatccgacggcgatcccggtgaccctgggtcacgagttc
tgcggcctcgtggaagaggtgggtgagggtgtttcgtcatttgtaggcggagaactcgtc
acggtcgatccgaatattgcctgcggtacctgccctgcctgccggcgtgggcggccgaat
ctctgcgccaacctcacggctatcggcgtgacgcgggatggcggctttgccgactatgtt
gcggttccctgcagccaggctttcacgctgcctccggatctcgatcccgtccatggcgcc
ttctgcgagccgctggcctgctgcatccatgccatcgacaaggcacaaatccgtccgggc
gatagcgttgccatattgggcggcggcgtgatcggcctgctcatggtccaactggcccgt
ttggccggcgcagaccagatcatccttgtcacgagacagctgtcgcggcgcgaggcggcg
ttgcgcctgggagcgacgctggccctcgacccgacggcgatcgatgcggttgccgccgtc
aaggacgcgacccatggcggcgttgacgtcgtcatagaatgtgccggcgttcccgaaacg
cttcagagcggcgttcggatggcgcggcgcggcggtgctttcgtgctcttcggtgtaacg
ccagcaggcctcgaagtgcccgttctgccattcgatctgctcgtcaatgaggtcgagatc
aggccggcctatctcaatccctttacccacgctcgcgccgccgccatggtggcaggcggg
attctggagctggattcgcttgttacgaagacgatcggccttgaagacgtcgcaggtgtg
gttggcagcgcgccgctggccggcgaaatcaaggtcatagtccggccctga

DBGET integrated database retrieval system