KEGG   Rhizobium tropici: RTCIAT899_PC06775Help
Entry
RTCIAT899_PC06775 CDS       T02432                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rtr  Rhizobium tropici
Pathway
rtr00010  Glycolysis / Gluconeogenesis
rtr00620  Pyruvate metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RTCIAT899_PC06775
   00620 Pyruvate metabolism
    RTCIAT899_PC06775
Enzymes [BR:rtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RTCIAT899_PC06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AGB75146
UniProt: L0LWR1
LinkDB All DBs
Position
pRtrCIAT899c:complement(1452814..1454322)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKLKYGNYIGGEWREPIAGKYFDNLTPITGGKICEIPRSDEKDINAALDA
AHAAKDKWGRTSTTERSNILMKIAQRMEDKLEVLAQAESWDNGKPIRETMAADIPLAIDH
FRYFASCIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVIKPAEQTPASLLVWAELVGDLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVAAEDDDFFDKALEGFAMFALNQGEVCTCP
SRALIQESVYDRFMERAVKRVEAIKQGNPLDAATMIGAQASSEQMEKILSYLDIGKQEGA
EVLTGGGRADLGGELSSGYYIKPTIFKGHNKMRVFQEEIFGPVVSVTTFKDEKEALEIAN
DTLYGLGAGVWTRDGNRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtggaatctccgttcaagctgaaatatggcaattacatcggt
ggcgagtggcgcgagccgatcgctggcaagtatttcgacaacctgacgccgatcaccggc
ggcaagatctgcgaaattccgcgctccgacgaaaaggacatcaacgccgcactcgatgcc
gcccatgcggcaaaggacaaatgggggcggacgtctaccaccgagcgctccaatatcctg
atgaagatcgcccagcgcatggaagacaagctggaagtgctggcgcaggccgaaagctgg
gacaatggcaagccgatccgcgagaccatggcggccgacattccgcttgccatcgatcat
ttccgttacttcgcctcctgcatccgcgcccaggaaggctcgatcggggagatcgaccac
gacaccgttgcctatcatttccatgagccgctcggcgtcgtcggccagatcattccttgg
aacttcccgatcctgatggccgcctggaagcttgcgccggcgcttgccgccggcaattgc
gtcgtcatcaagccggcagaacagacgccggcttcgcttctggtctgggctgagctggtt
ggcgatctcctgccgccgggcgtgctcaacatcgtcaatggcttcggcctggaggccggt
aaaccgcttgcaacgagcccgcgcatcgccaagatcgcctttaccggcgagacgacgacg
ggccggctgatcatgcaatatgcgagccagaacctgatccccgtcacgctcgaactcggc
ggcaagtcgccgaacatcttctttgccgatgtcgcggccgaagacgacgatttcttcgac
aaggcgctcgaaggctttgcaatgttcgcgcttaaccaaggcgaggtctgcacatgcccg
agtcgagcgctgatccaggaatcggtctacgaccgcttcatggagcgtgccgtcaagcgc
gtggaagccatcaagcagggcaatccgcttgatgccgcaaccatgatcggcgcccaggca
tcgagcgagcagatggagaagatcctctcctatctcgatatcggcaaacaggaaggcgcc
gaagtgctgacgggcggtggtcgcgccgatctcggcggcgagctgtcgagcggctattac
atcaagccgaccatcttcaaggggcataacaagatgcgggtcttccaggaggagatcttc
ggcccggtcgtatcggtcacgaccttcaaggatgagaaggaagcgctcgaaatcgcaaac
gatactctctatggcctcggcgccggcgtatggacccgtgacggcaatcgcgcctatcgc
ttcggccgggagatccaggccggccgcgtctggacgaattgctatcacgcctatccggcc
cacgccgctttcggcggctacaagcaatcgggcatcggacgtgagacgcacaagatgatg
ctcgatcactaccagcagaccaagaacatgctggtcagctacagcccgaaggcgcttggc
ttcttctga

DBGET integrated database retrieval system