KEGG   Rhizobium tropici: RTCIAT899_PC09145Help
Entry
RTCIAT899_PC09145 CDS       T02432                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rtr  Rhizobium tropici
Pathway
rtr00500  Starch and sucrose metabolism
rtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RTCIAT899_PC09145
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     RTCIAT899_PC09145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Syncollin
Motif
Other DBs
NCBI-ProteinID: AGB75616
UniProt: L0LY51
LinkDB All DBs
Position
pRtrCIAT899c:complement(1962773..1965193)
Genome map
AA seq 806 aa AA seqDB search
MAPYDASGPNVNGIEPRWTSSAKSGVGTALSPACRIWFTLSHGILNEIYYPRVDSACTRD
IGLIVTGPDGYFSEEKRDTESVVTTVEDGVPAYRLINTAIDGRYRIIKRIIVDPMRSSLL
QQISFEPLEGTIHDYRLYLLAAPHLVNAGYGNTGWVEDYKGTPMLFAAGTGGVSMALAVS
GGWRTASAGYVGISDGWQQLQKEARLDPAVARAVDGNVALTGEIDLIGGSDTVTVSLGFG
SHSKEAGYNALASLQAGYDGAERSYVADWRAWQDGLLALDEPRAPPPEVNRYRISTAVLA
THRPLSFEGPAVASLSIPWGFAKGDEDLGGYHLVWPRDLVETAGGFLAAGASQDALRILA
YLRVIQEEDGHWPQNCWLDGEPYWSGIQMDECAFPILLADALRREGVLTGDLLLSYVPMV
ESAARYVVVNGPVTGEDRWEEDGGFSPFTLAVEIAALLAAADILEIAGQTHNADYLRQTA
DAWNDQIERWTYVSSDAENAALGVKGYYVRIAPPEIADGSSPADGFVPIKNRPPAESFLP
TARVVSPDALALVRFGLRAADDPRILDTVRVIDAQLKCDLPQGSLWYRYTGDGYGEHEDG
GPFDGTGIGRPWPLLAGERAHYELAAGRPEVALGLLKTLEQSAGQGGLLPEQVWDQPDVP
ALGLALGKPSGSAMPLVWAHAEHIKLLRSLRDGAVFDMPPQGVERYVKNKMTAPFVPWRF
NNKLSQLSVGKRLRIEVMARAIIRWSVDGWASASDTETSQNGFGIHVAELSCERLPKGGS
IAFTFYWPDTDRWEGEDFSVSVVETP
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcaccttacgatgcttccggccccaacgtgaacggtatcgaacctcgttggacgtcc
agtgcaaagagcggagttggcacggcgctttcgccggcctgccgcatctggttcactctc
agtcacggcatcttgaacgaaatctattatccccgcgtcgacagcgcctgtacccgcgac
atcggattgatcgtcacaggtcccgatggttatttttcggaggaaaagcgcgatacggag
agcgtcgtcaccacggtcgaggatggcgttccggcctatcggttgatcaatactgcaatc
gacgggcgttacaggatcatcaagcgcatcatcgtcgacccgatgcgcagcagcttgctc
cagcagatatcgttcgaaccgcttgagggaacgatccacgattatcgtctctatctgctt
gccgctccgcatctggtcaatgccggttacggcaatacggggtgggtggaagactataag
ggcacgccgatgctttttgcggcggggacaggcggtgtctcgatggctcttgcggtcagc
ggcggctggcgaacggcatctgccggctatgtcggtatttccgacggatggcagcaattg
cagaaagaggcccggttggacccggccgtcgcgcgtgccgtcgacggcaacgtcgccctg
accggtgagatcgatctgatcggcggcagcgacaccgtcaccgtatcgctcggcttcgga
agccattccaaagaggccggctacaatgcccttgccagtctgcaagccggctatgacggc
gccgagcgcagctatgttgccgactggcgggcctggcaagacggattgctggccctcgac
gaaccgagagcaccgccgcccgaagtcaatcgctatcgaatctcgacagccgtgctggca
acgcaccgaccactttccttcgaagggccggccgttgcttctctctccattccttggggc
tttgccaagggcgacgaagacctcggtggctatcatctggtctggccgcgcgatctggtc
gagaccgccggcggcttcctggccgcgggcgcttcgcaggatgcgctgcgcattctggcc
tatctgcgcgtcatccaggaagaggatgggcattggccgcagaattgctggctggacggc
gagccttactggagcgggatccaaatggacgaatgcgcgttcccgatcctgcttgccgat
gcgctgcgccgcgaaggagtccttacgggcgatctattgttgtcctacgtgccaatggtc
gaaagcgcagcgcgctacgtcgtcgtcaacggccccgtcacgggtgaggaccgctgggag
gaggatgggggcttttctcccttcaccttggcggttgagatcgctgcgctattggcggcg
gccgatattctggaaattgccggtcagacgcacaatgcggactatctgcggcagactgcg
gacgcctggaacgaccagatcgagcgctggacctatgtcagcagcgatgccgaaaacgcc
gctctcggggtcaagggctattatgtccgtattgcgccgcctgaaatcgccgacgggagc
tcgcccgccgatggtttcgtgccgatcaagaacaggccgcccgctgaatccttcctgccg
accgctcgcgtcgtcagtcccgatgccttggcgctggtgcggttcggattgcgagccgcc
gatgatccccgcatcctcgacacagtcagagttatcgatgctcagctcaaatgtgacctg
ccgcaagggtcgctatggtatcgctataccggcgacggctatggcgagcatgaagacggt
gggccattcgacggcaccggtattgggcgcccatggccgttgctggcgggcgagcgcgcc
cattatgagctcgcggccggtcggccggaagtggctcttggattgctcaagacactcgag
cagtctgccgggcagggcggattgctgccggaacaggtgtgggaccagcccgatgtcccg
gcactgggactcgccctcggaaaaccttccggcagcgccatgccgctggtctgggctcat
gcggagcatatcaagctcctgcgctcgctgagagacggggcggttttcgacatgccgccg
caaggtgtcgagcgctatgtaaaaaacaagatgacggcacccttcgtaccatggcgtttc
aacaacaagctgtcgcagctttccgtcggcaagcgcctgcggatcgaggtcatggcgcgg
gcgatcattcgctggagtgtcgacggctgggccagcgccagcgataccgaaacgagccag
aacggcttcgggatacatgtcgcggagctgtcatgcgagcgcctgcccaaaggcggttcg
attgcctttaccttttactggcctgacaccgaccgctgggagggagaggatttctccgtc
tccgtcgttgaaacgccatag

DBGET integrated database retrieval system