KEGG   Rhizobium tropici: RTCIAT899_PC09420Help
Entry
RTCIAT899_PC09420 CDS       T02432                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rtr  Rhizobium tropici
Pathway
rtr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RTCIAT899_PC09420
Enzymes [BR:rtr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RTCIAT899_PC09420
DNA repair and recombination proteins [BR:rtr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RTCIAT899_PC09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AGB75670
UniProt: L0M010
LinkDB All DBs
Position
pRtrCIAT899c:2025945..2028521
Genome map
AA seq 858 aa AA seqDB search
MALETYNRKRDFSRTTEPRGRAGKKKIAISGNSYVIQKHDARRLHYDFRLELDGVLKSWA
VTKGPSLIVGEKRLAVQTEDHPLEYGDFEGTIPKGEYGGGTVIVWDKGSWTPLGDPHKGL
AKGHLEFELHGKKLGGRWHLIRMAGKPREKRENWLLIKGEDEAARPEGAADILEERPESA
KTGRIIDEVENEKPGWSSKSGKIRRRTSRKKDDDAKEEADKAETQTDATPVDPSSLKGAL
KAPLPSFVEPALATLVSKPPSGSRWLHEIKFDGYRLEVRIEAGRIKLLTRSGLDWSQKFG
KEIVSAFRDLPVGTAIIDGELVVEPAAGASDFSALQADLSEGRSDRFVFYAFDLLYLDGY
DLKASPLIGRKELLRKIIPSETGILRFSSHFDENGDLLLSHACRLSLEGIVSKIANDPYR
PGRGKSWVKSKCSSRQEFVIGGWVPSTTSRKAIGSLVLGVYQDGKLEHVGRVGTGYTHTV
AEQLFKRLTRLQVKENPFATKLTAEEHRGVRFVQPELVAEVEFRAWTADGHLRHASFRGL
REDKNPLEIVRETPKSTRESSAEKPARSSVSLTHGDRLYWPDEGVTKAGLADYYAEVWRY
MGPFVVGRPLALVRCPNGIAGQHFFQKHAWKGMNRNIALAKDPQDEEPYVSIDDLNGLIG
LVQAAVLEIHPWGSMIGNWEKPDMIIMDLDPGPDVAWSKVIAAAEETAERLRQTGLVPFV
KTSGGKGLHIVCPLVARAEWPAVKAFTKGIADAMAADSPDRYVSTITKSKRRGKILIDYL
RNQRGSTAVAPYSTRARPGAAVSMPLLWEELSPAIGPDYFTVLNVPTRLAALHSDPWADF
RKAAEPLPQPAAKAKRKL
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcattggagacctacaaccgcaaacgcgacttcagcaggacaaccgagccgagagga
cgagccggcaagaaaaagatcgcaatatccggcaacagctacgtcatccagaagcatgac
gcgcgccggctccactatgattttcgcctcgaattggacggagttttgaagagctgggcc
gtgaccaaagggccgagcctgatagtcggagaaaaacggctcgcggtgcagaccgaagat
cacccactggagtatggtgatttcgaaggcacgatccccaagggcgaatatggcggcggg
accgtcatcgtctgggacaagggctcttggacgccgcttggcgacccccataagggcctt
gcaaagggacatctcgaattcgagctccacggaaagaaactcggcggccggtggcatctg
atccgcatggcgggaaagccacgcgagaagcgggaaaactggctgctgatcaaaggcgaa
gacgaggcggcccgcccggaaggcgctgccgatattctcgaggaacgaccggaatcggca
aaaacggggcgtattatagacgaagtcgagaacgaaaagccgggctggtcttcgaagagc
gggaagatccgtcgcaggaccagccgaaagaaggatgatgacgccaaggaggaagccgac
aaagccgaaacgcaaacggatgcaacgcccgttgatccctcatctttgaagggtgccctc
aaggctcctctgccgtccttcgtcgaacctgctttggcgacattggtatccaaaccacct
tcgggctcccggtggcttcacgaaatcaaattcgatggctatcggctcgaggtccgcatc
gaggcaggccgcatcaagctgctgacacgcagcggcctcgactggagccagaaattcggc
aaggagattgtcagcgccttccgggatctccccgtcggcaccgcaatcatcgacggcgag
ctggtcgttgagccggcggccggcgcttccgatttctctgccctgcaggcggatctcagc
gaaggccgtagcgaccgcttcgtcttctatgctttcgatctcctctatctggacggatac
gacctgaaggcctcgcctctgatcggccgcaaggaattgctgcggaagatcatcccatcc
gaaaccgggatccttcgcttcagcagtcatttcgatgaaaatggcgacctgctgttgtcg
catgcctgcaggttgagcctggaagggatcgtatcgaagattgccaacgatccatatcgc
cccggccgcggcaagtcatgggtgaaatcaaaatgttcgtctcggcaggaattcgtgatc
ggcggctgggtcccatcgacaacgtcacgaaaggcgatcggctcgctggtgctcggcgtc
tatcaagacggcaagctcgaacatgtcggccgcgtcggtacgggatacacgcacactgtc
gccgagcagctcttcaaaaggctaacccgcctgcaagtgaaggaaaatcctttcgcaacc
aagctcaccgcggaagagcatcgcggtgtccgcttcgtgcagcccgaactggttgcggaa
gtcgaatttcgcgcctggacggcggacggccatttgcgccacgcctccttccgcggattg
cgagaagacaagaacccgctcgaaatcgttcgcgaaacaccgaaatccacgagggagtcc
tcagctgagaagccggcgcgcagcagcgtatccttgacccacggcgatcgcctctattgg
cctgacgaaggtgttacgaaggcggggcttgcggattattatgccgaggtctggcgttat
atggggcctttcgtcgtcggccggccgctcgcgctggtacgctgtcccaacgggattgcc
ggtcagcattttttccagaagcatgcctggaagggcatgaaccggaacatcgccttggcg
aaagatccgcaagacgaagagccctatgtcagcatcgacgacctgaatggcctgatcggc
ctcgtgcaggcagcagtcctcgaaatccatccctggggatcgatgatcggcaactgggaa
aagcccgacatgatcatcatggacctcgatccgggcccagacgtcgcctggagcaaagtc
atcgccgccgcggaagaaacggcagaacggctgaggcaaacagggctcgttcctttcgtg
aaaacttcgggcggaaaagggctgcacattgtctgcccgctggttgccagggccgaatgg
ccagcggtcaaggcctttaccaagggtatcgccgacgccatggccgccgacagccccgat
cgttatgtttccaccatcaccaagtcgaaacgccgcggcaagatcctgatcgattatctg
agaaatcaacgcggctcgactgccgtcgcgccctactccacccgcgcccggccgggcgcc
gccgtctcgatgcctttattatgggaggagctgagcccggcaatagggccggactatttt
accgtgctcaatgtgccgacgcggcttgccgcgctccattcggatccctgggccgacttc
cggaaagccgccgaaccgttgccccagcccgccgcgaaggccaagcgtaagttataa

DBGET integrated database retrieval system