KEGG   Rathayibacter toxicus 70137: TI83_04940Help
Entry
TI83_04940        CDS       T03670                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rtx  Rathayibacter toxicus 70137
Brite
KEGG Orthology (KO) [BR:rtx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtx01001]
    TI83_04940
Enzymes [BR:rtx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TI83_04940
Protein kinases [BR:rtx01001]
 Serine/threonine kinases: Other
  Bacterial family
   TI83_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Haspin_kinase Kdo RIO1 Pkinase_fungal LysE FTA2
Motif
Other DBs
NCBI-ProteinID: AJM77468
UniProt: A0A0C5B9G9
LinkDB All DBs
Position
complement(1090897..1092849)
Genome map
AA seq 650 aa AA seqDB search
MTTSQLDPLLGRLVDGRYEVRSRIARGGMATVYLAHDQRLERRVAMKIMHGHLADDTTFK
NRFVQEARSAARLAHPNVVSVFDQGQDSDMAYLVMEYLPGITLRDLLKERRRLTAQQVVD
IMHSVLSGLAAAHRAGIVHRDLKPENVLLADDGRIKIGDFGLARAATANTASGQALLGTV
AYLSPELVTRGTADTRSDIYAIGIMIYEMLTGEQPFTGEQPMQIAYQHANDSVPYPSATV
PSVPTSLDELVIWATERDPDMRPRDAGVMLAQLLEAERSMGITPSGRHDDTQAVTPLPSA
ESTILLPYEDVLSGPASGFTEPGGDELVPVEDDAVARLAAQGRVRRRRGAVLVLLVLLLA
LLGGGAAWWFGEGPGALRSIPSVVGLSKEDAISSLEAQGFVAQPETTPDTHVPVGTVMST
QPAATENVKKGSVVTLTVSSGPRQLPVPALAGLTQKEAEAAIAGGSFQVGDTTKIFDPKV
KAGVVISASLPDGSALPGSLSENSTIALVVSLGPIPNVVGLSVDDATNKAKAAGLALNRS
GEDWSDSVAAGIVLTQANPKSPATTGATISVVVSKGPKPVSVPNVVGMTRDQAKAALEAV
GLSSSYSLTTLGPLIDTAPNEITKVTNQSNKAGDQVQRGTTIQLSLTITT
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccagtcaactcgaccctctactcggccgtctcgtcgacggccgctacgaggtc
cgttcgcgaattgcgcgcggaggcatggccacggtctacctcgcgcacgaccagcgcctc
gaacgcagagtcgcgatgaagatcatgcacgggcatctcgcagatgacacgacgttcaag
aatcgcttcgtccaggaggcgcgctccgccgcacggctggcacatccgaacgtggtcagc
gtgttcgaccagggccaagactccgacatggcctacctggtgatggagtacttgcccggg
atcaccctccgcgacctcctcaaggagcgcagacgtttgacggcacagcaggtcgttgac
attatgcactcggtgctctcaggtctcgccgccgcccaccgtgccggaattgtgcaccgc
gatctcaagccagagaacgtactgctcgctgatgacggtcgcatcaaaatcggcgatttc
ggtctggcccgcgccgccacagccaataccgcctccggccaggcgctactgggcaccgtc
gcctatctctcccccgaactcgttacccgcggcaccgccgacactcgcagcgacatctac
gcgatcggcatcatgatctacgagatgcttactggcgagcagcccttcacgggcgagcag
cccatgcagatcgcgtatcaacacgcgaacgattccgtgccctatcccagcgctaccgtc
ccctccgtgcccacttcgctcgacgagcttgtcatctgggcaacggagcgtgaccccgat
atgcgaccgcgcgatgccggagtcatgctcgcacaactcttggaagccgaacgatcgatg
ggtatcacgcccagcggacgacacgacgatacccaggcggtcactcctctcccttcggcg
gagtccacgatcttgctgccgtatgaggacgtcctttccggaccagccagtgggttcacc
gaaccgggcggagacgaactcgttcctgtagaggatgacgcagtcgcacgtcttgccgcg
caaggccgcgtgcgacggcgacgtggtgccgtgcttgtcctgctcgtgctcctgctcgct
ctcctggggggaggcgccgcctggtggttcggtgagggcccgggcgcactccgatccatt
ccttcggtcgtcgggctctcgaaagaggacgccattagctcactggaagcccagggtttc
gtcgctcagcccgaaaccaccccggatacgcatgtcccggttggcacggtaatgagcacg
cagcccgccgcgacagaaaacgtcaagaagggctcggtcgtcacgctcaccgtttccagc
ggtccgcggcagctgccggtgccggctctcgcgggactgacccaaaaggaggcagaggcc
gcgatcgctggcggctcctttcaggtgggtgacaccactaaaatcttcgaccctaaggtg
aaggccggagtggtgatctcggcatccctgcccgatggttccgcgctgcccggctctctg
tccgaaaacagcacgattgccctcgtggtaagcctcggtccgatcccgaacgtggtcggt
ctctccgtcgacgacgcgactaacaaagctaaggccgccggattggcactgaatcgcagc
ggtgaggactggagcgattccgtcgccgcgggcatcgtgctcacccaagcgaacccgaaa
tcccccgccacaacgggcgccaccatttcggtcgtggtgtcgaaaggtccgaagccggtc
tcggtgcccaacgtagtggggatgacccgtgaccaagccaaggcagctctggaggcggtc
ggactctcgtcgagctactcgctgacaaccctcggcccgttgattgatacggcaccgaac
gaaatcactaaagtcaccaaccagtccaacaaggccggtgaccaggttcagcgcggcacc
accatccagctctccctcacgatcaccacctga

DBGET integrated database retrieval system