KEGG   Rickettsia typhi Wilmington: RT0353Help
Entry
RT0353            CDS       T00193                                 

Gene name
fabI
Definition
(GenBank) Enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rty  Rickettsia typhi Wilmington
Pathway
rty00061  Fatty acid biosynthesis
rty00780  Biotin metabolism
rty01100  Metabolic pathways
rty01130  Biosynthesis of antibiotics
rty01212  Fatty acid metabolism
Module
rty_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rty00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RT0353 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RT0353 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RT0353 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rty01004]
    RT0353 (fabI)
Enzymes [BR:rty01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RT0353 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RT0353 (fabI)
Lipid biosynthesis proteins [BR:rty01004]
 Fatty acid synthase
  Component type
   RT0353 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AAU03832
UniProt: Q68X10
LinkDB All DBs
Position
complement(444573..445358)
Genome map
AA seq 261 aa AA seqDB search
MTTRLLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEALEKRVKPLAEEIGCN
FISELDVTDQKSISNLFNDIKEKWNSFDFLLHGMAFANKNELKGRYVDTSLENFYNSLHI
SCYSLLELSRSAETLMHDGGSILTLTYYGAEKVIPNYNIMGVAKAALEASVKYLANDMGE
NNIRVNAISAGPIKTLASSAISDFSTMLKFHASTAPLKRNITQEDVGGAAVYLFSELSKG
VTGEIHYVDCGYNIIGSSKLL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaggttactacaaggaaaaaaaggtttaattacaggtattgcaaataacatg
tcaatatcatgggcgattgcacagcttgccaaaaaacacggagcagaattatggtttact
tatcaatcagaagcactcgaaaaacgagttaaaccgcttgctgaggaaataggttgtaat
tttattagtgaacttgatgtaacggatcaaaaatcaattagtaatttatttaatgatata
aaagaaaaatggaatagttttgattttttactccatggtatggctttcgcaaataaaaat
gaattaaaagggcgttatgtcgatactagcttagaaaatttttataattctttacatata
tcatgttactcgcttttagaactctcaaggtctgcagaaaccttaatgcatgacggtggt
agcattttaacattaacgtactacggcgctgaaaaagttatacctaattataacattatg
ggagtagcaaaagcagcacttgaggctagtgtcaaatatctagcaaacgatatgggagaa
aataatattagagtcaatgctatttcggcaggccctatcaaaactttagcatctagtgca
ataagcgattttagtactatgcttaaatttcacgcttcaactgcaccattaaaacgtaat
attactcaagaagatgtaggaggagcagctgtatatttatttagtgaattatctaaaggt
gttacaggcgaaattcattatgtagattgcggttataatattatagggagtagtaaatta
ttgtag

DBGET integrated database retrieval system