KEGG   Ruegeria sp. AD91A: D1823_00075Help
Entry
D1823_00075       CDS       T05627                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00240  Pyrimidine metabolism
rua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D1823_00075
Enzymes [BR:rua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D1823_00075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AXT25144
UniProt: A0A346SCN1
LinkDB All DBs
Position
complement(13449..14027)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASHNYRERGMQTYLMTAAIDGRAGAGRIASRIGISEEAD
TFTPRDDVFAMIRNRLNEGPVTCVFIDEAQFLSEAQVWQLARAVDDLDVPVLAYGLRVDF
QGKLFPGSAALLALADEMREVRTICKCGRKATMVIRQDENGTAITEGAQVQIGGNETYVS
LCRKHWREAVGD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctgtatttcaactattcgaccatgaacgcggggaaatcgaccgtgttgctg
caagcatcgcacaactatcgcgagcgtgggatgcagacctacctgatgaccgcagccatt
gacggaagggcgggtgccggacggatcgcatcgcgcatcggcatctcggaggaggctgat
accttcacgccccgagacgacgtctttgcgatgatccgaaatcgtctgaacgaaggtccc
gtaacctgcgtgttcattgacgaggcccagttcctgtctgaagctcaggtctggcaattg
gcgcgggccgtcgacgatctggacgtacctgtgctggcctacgggttacgggtggatttt
cagggcaagctgtttccgggatcagcggcgctgctggcgctggccgatgagatgcgtgaa
gtccgcaccatatgcaaatgcggacgcaaggccacgatggtgatacgtcaagacgaaaac
ggcacagccatcaccgaaggtgcccaggtgcagatcggcggcaacgagacctatgtctcg
ctctgccgcaagcattggcgcgaggcggtgggcgactag

DBGET integrated database retrieval system