KEGG   Ruegeria sp. AD91A: D1823_12120Help
Entry
D1823_12120       CDS       T05627                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00020  Citrate cycle (TCA cycle)
rua00190  Oxidative phosphorylation
rua00650  Butanoate metabolism
rua01100  Metabolic pathways
rua01110  Biosynthesis of secondary metabolites
rua01120  Microbial metabolism in diverse environments
rua01130  Biosynthesis of antibiotics
rua01200  Carbon metabolism
Module
rua_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rua_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rua_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D1823_12120
   00650 Butanoate metabolism
    D1823_12120
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    D1823_12120
Enzymes [BR:rua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     D1823_12120
    1.3.5.4  fumarate reductase (quinol)
     D1823_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer2 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AXT27264
UniProt: A0A346SIQ1
LinkDB All DBs
Position
complement(2429226..2430005)
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSRIITGKTWPKPDGATNVRKFQIYRWNPDDGQNPRVDTYFVDMDTCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGMDEIKGDVKIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWKQSIEDRKKLDGLYECVMCASCSTSC
PSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDELEDPFKLYRCHTIMNCAKTCPKG
LNPAKAIAEIKKMMVERAV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaactgaccctgcccaagaattcccggattatcaccggcaagacctggccaaag
ccggacggcgccacgaacgtgcgcaagttccagatctatcgttggaaccccgatgacggg
cagaacccgcgtgtcgatacgtatttcgttgatatggatacgtgcggtccgatggttctg
gacgcgctgatcaagatcaaaaacgagattgatccgaccttgacgttccgccggtcttgc
cgcgaaggcatctgtggatcctgcgcgatgaatatcgatgggatcaacacgctggcctgt
atctatggcatggatgagatcaagggcgacgtgaaaatctacccgttgccgcacatgccg
gtggtcaaggacctgatccctgatctgacccatttctatgcccagcatgcgtccatcatg
ccatggctggaaaccaagaccaatcgccctgcgaaggaatggaagcagtccatcgaagac
cgcaagaagctggacggtctttatgaatgtgtgatgtgcgccagctgctcgacttcatgc
cccagctactggtggaacggcgatcgctaccttggccccgcggccttgctgcacgcctat
cgctggatcatcgacagccgggatgaggcgacgggtgaacgtctggatgagctggaagat
ccgttcaagctctaccgctgtcacacaatcatgaactgcgccaagacctgtccgaaaggt
ctgaacccggccaaggcgattgccgagattaagaagatgatggttgagcgcgcggtttaa

DBGET integrated database retrieval system