KEGG   Ruegeria sp. AD91A: D1823_12135Help
Entry
D1823_12135       CDS       T05627                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rua  Ruegeria sp. AD91A
Pathway
rua00020  Citrate cycle (TCA cycle)
rua00190  Oxidative phosphorylation
rua00650  Butanoate metabolism
rua01100  Metabolic pathways
rua01110  Biosynthesis of secondary metabolites
rua01120  Microbial metabolism in diverse environments
rua01130  Biosynthesis of antibiotics
rua01200  Carbon metabolism
Module
rua_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rua_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rua_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D1823_12135
   00650 Butanoate metabolism
    D1823_12135
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    D1823_12135
Enzymes [BR:rua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     D1823_12135
    1.3.5.4  fumarate reductase (quinol)
     D1823_12135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 FAD_oxidored GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AXT27267
UniProt: A0A346SIQ4
LinkDB All DBs
Position
complement(2431435..2433240)
Genome map
AA seq 601 aa AA seqDB search
MAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
SNMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQ
CQGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTLE
IREGRGVGAEGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTTDDPTAIVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGKVVDAESANPVLNQASVDKAFDRFDAVRNASGSIPTADLRLEMQKTMQADAAVFRTA
KTMAEGVEKMTAIAAKMDDLKVTDRSLVWNSDLMETLELANLMPNALATIVGAEARKESR
GAHAHEDFSERDDENWRVHTVSRVEGNKVELGYRPVIVDPLTTEDQGGISLQKIAPKART
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatacgaatacgaaacgcatgaatatgacgtggtcgttgtcggcgccggtggg
gccggtctgcgggcgacattgggtatggcagaacaaggtctgcgcacggcttgcgtaacc
aaagttttcccgacgcgttcccataccgtggccgcacagggtggcattgccgcgtcgctg
tcaaacatgggccccgaccattggcagtggcacatgtacgacaccgtcaagggctcggac
tggttgggcgataccgacgcgatggagtatctcgcgcgggaggcacccaaggcagtctac
gagctggagcactatggcgttccgttcagccggacggaagagggcaagatttatcagcgc
cccttcggtgggcacaccactgaattcggagagggtcctgcggtacagcgcacttgtgca
gccgccgaccggacaggccacgcgattttgcatactctgtacgggcagtcgctcaagaat
aacgccgagttctatatcgaatatttcgccatcgacctgatcatgtccgaggacggccag
tgtcagggggtcgtctgctggaaactggacgacggcaccatgcatgtcttcaacgccaag
atggtggttctggcgaccggcggctatggccgtgcctatttcagcgcgacctcggcccac
acctgcaccggcgatggtggtggcatggtggcccgagcagggctggccttgcaggatatg
gagttcgttcagttccacccaaccggcatctacgggtcaggctgcctgatcaccgaaggt
gcgcgcggcgaaggcggttacctgacaaactcggaaggtgaacggttcatggagcgctat
gcgccccagtacaaggatctcgcaccgcgcgactacgtttcgcgctcgatgaccttggaa
atccgcgagggacggggcgtaggggccgaaggggatcacattcacctgaacctcagccac
ttgcctgccgaggctctggcggaacgcctgcctggcatctcggaaagcgccaagattttt
gcgggtgtggatgttaccaaggaaccgataccggttctgcccaccgtgcattacaacatg
ggcggtatccccacgaactattggggtgaggttctgaacccgaccaccgatgacccaacg
gcgattgttcctggattgatggccgttggcgaagccggctgtgcctcggtccacggggcg
aaccgactggggtcgaactcgttgattgaccttgtggtctttggccgggcggcagcgatc
cgggctggcaaggttgtcgacgccgaatccgcgaacccggttctgaaccaggcgtcggta
gacaaggcgtttgaccgttttgatgcggtgcgtaacgccagtggttcaatcccaaccgct
gatctgcggcttgagatgcaaaagaccatgcaggcggacgcggccgtgttccgaaccgcc
aagaccatggccgaaggcgtcgagaagatgacagcgattgccgcaaagatggacgacctg
aaagtcacagaccgttcattggtctggaacagcgatctgatggaaacccttgaactggcc
aacctgatgccaaacgcgcttgccaccatcgtcggcgccgaggcccgcaaggaatcccga
ggggcccatgcgcatgaggacttcagcgagcgtgatgacgaaaactggcgcgttcatacg
gtcagccgggttgagggcaacaaggttgagctcggctaccgtccggttatcgttgatcca
ctgacgaccgaagaccaaggcggtatcagcctgcagaaaatcgcgccaaaggcgcggacg
ttctaa

DBGET integrated database retrieval system