KEGG   Ruegeria sp. AD91A: D1823_13195Help
Entry
D1823_13195       CDS       T05627                                 

Definition
(GenBank) iron ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
rua  Ruegeria sp. AD91A
Pathway
rua02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rua00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    D1823_13195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rua02000]
    D1823_13195
Transporters [BR:rua02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    D1823_13195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AXT27446
UniProt: A0A346SJ83
LinkDB All DBs
Position
2635192..2636208
Genome map
AA seq 338 aa AA seqDB search
MLKSTTCLAAALSALIATSAAAEGELNLYSSRHYDTDERLYTDFEDATGIKINRIEGKAD
ELIARMEAEGANSPADVMLTVDTSRLARAKDAGILQAIDSETMEERIPANLQDEDNQWFG
FSQRGRIIFYNKENVTNPPATYADLAKPEYKDLICIRSSTNTYNQTLLASIITHEGAEAA
KFWAEGVVANMARDPQGGDTDQLRGIVSGECDIAVSNTYYYARAIRKDVKGLSSDLDMIG
WVFPNQDSYGAHMNLSGGGVAAHAPNKENAILFLEYLASDQAQEYFSAGNDEFPAVQSVE
LADSVKALGDFKADDVNLSDVAKNIPEAQKIFNEVGWK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaatccacaacctgcctggccgccgctctgtcggcattgatcgcaacatccgcc
gcggctgaaggcgagctgaacctttattcgtcgcgccactatgacaccgacgaacgtctg
tacacggacttcgaagatgcgactggtatcaagatcaaccggatcgaaggcaaggcagac
gagttgatcgcgcgcatggaagcagaaggcgcgaactctcctgccgacgttatgctgacc
gtcgacacttctcgtctggcgcgtgccaaagatgcgggcattctgcaagctatcgacagc
gaaaccatggaagagcgcatccccgccaaccttcaggacgaagacaaccagtggttcggc
ttctcacagcgcggtcggatcatcttttacaacaaagaaaacgtcaccaacccgccagcc
acttacgcagacctggccaagccggagtacaaggacctgatctgcatccggtcctcgacc
aacacctacaaccagaccctgctcgcctcgatcatcacacatgaaggcgcagaagctgca
aagttctgggcggaaggcgttgtcgccaacatggcgcgggacccgcaagggggtgacacc
gaccagctgcgtggcatcgtttcgggcgaatgcgatatcgctgtgtcgaacacttactac
tatgcacgggccatccgcaaagacgtcaaaggtctttcctctgacctcgacatgatcggt
tgggtcttccccaatcaggacagctatggtgcgcatatgaacctatcgggcggtggcgtc
gcggcgcacgcaccgaataaggaaaacgcaatcctgttccttgagtatctggcaagcgat
caggcgcaggagtacttttcggcaggaaatgacgaattcccggcagtacagagcgttgag
ctggcagattcggtaaaagcactgggtgacttcaaagctgacgacgtgaacctgtcagac
gtcgccaagaacatcccggaagcacagaaaatcttcaacgaagttggctggaaataa

DBGET integrated database retrieval system