KEGG   Rufibacter sp. DG15C: TH61_03110Help
Entry
TH61_03110        CDS       T04326                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rud  Rufibacter sp. DG15C
Pathway
rud00240  Pyrimidine metabolism
rud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rud00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    TH61_03110
Enzymes [BR:rud01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     TH61_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Zn_ribbon_SprT
Motif
Other DBs
NCBI-ProteinID: AMM50371
UniProt: A0A127AZ44
LinkDB All DBs
Position
complement(740423..741016)
Genome map
AA seq 197 aa AA seqDB search
MFIEPRVGNRQQTQKRGWIEVICGSMFSGKTEELIRRLNRAKIAKQCVEIFKPAIDTRYH
DEDVVSHNATSIRSTPIQFANDMLLLGSSCDVLGVDEAQFFDDAITDVCVQLANSGVRVI
VAGLDMDYLGKPFGPMPALMGVAEYVTKVHAICVQCGEIASYSFRNAASQEKVLLGETDS
YEARCRHCFQEGLKGKL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttcatagagcctcgggtgggaaaccgccaacagacccagaagcgtggttggatagaa
gtgatttgcgggtctatgttctcaggaaagaccgaagagctcatacgccggctcaaccgc
gccaagattgccaaacagtgcgtggagattttcaagccggccattgacacgcgttaccat
gatgaggacgtagtgtcgcataacgccacctccatccggtccacgcccatccagttcgcc
aacgacatgctcttgctgggcagcagctgtgacgtactgggcgtagacgaggcccagttc
tttgacgatgccatcactgatgtctgcgtgcagctcgccaactcaggcgtgcgcgtgatt
gtcgccggactggacatggactacctgggcaaacccttcggacccatgccggccttgatg
ggcgtagccgagtacgtgaccaaagtacacgccatctgcgtgcagtgcggtgaaattgcc
tcgtactcttttagaaatgccgcctcccaagagaaagtgttattaggcgaaacggactcg
tacgaggcccgttgccgtcactgctttcaagagggattgaagggaaagctttaa

DBGET integrated database retrieval system