KEGG   Rufibacter sp. DG15C: TH61_03375Help
Entry
TH61_03375        CDS       T04326                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rud  Rufibacter sp. DG15C
Pathway
rud00564  Glycerophospholipid metabolism
rud01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rud00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TH61_03375
Enzymes [BR:rud01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TH61_03375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like Lycopene_cycl NAD_binding_8 Pyr_redox_3 Thi4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AMM50418
UniProt: A0A127AZU0
LinkDB All DBs
Position
803495..805078
Genome map
AA seq 527 aa AA seqDB search
MEESQPFVFNREHFLRKVQEETVWDVVVIGGGATGLGIAVDAASRGYKTLLLEQADFAKG
TSSRSTKLVHGGVRYLALGHIKLVLEALRERGRLLQNAPHLVTIQSFIIPTFSWWDKLVY
GLGLTLYDLMAGRLRLRRTAFLSAQETAQQLPNIKTKGLTGGVQYFDGQFDDTRLAINLA
QTCAEQGGLLLNYMPVVNLLKDARGKVIGVTAQDIEFGQEYVIQAKTVINATGVFVNSIL
HMDAPAQQPLVRPSQGVHVVLDQSFLKGENALMIPKTSDGRVLFMVPWHGYLLVGTTDTL
VNETSLEPKPQEQEIDFILETASHYLARKPTRADVLSVFAGQRPLAAPTIHTHKTKEISR
SHSLLVAPSGLITVTGGKWTTYRQMAEDAIDLAITKGFLLPLDCQTAQLKIHGYTVEENP
ADPLAIYGTDKVGILALVQQFPDLGIPLHPNFSHIAAEVVWAAQYEMARTVEDVLARRLR
VLFLDARAALEMAPKVAQLMAVALHKDAAWEENQIHQFTQLASQYIL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagccagccattcgtctttaaccgagagcattttctgcggaaggtgcaggaa
gagactgtttgggacgtggtggtgattggcggcggggccaccggcttgggcattgccgtg
gacgcagcctcccgcgggtacaaaacgttgttgctggagcaggcggactttgccaagggc
acttccagcaggagtaccaaactggtccacggcggcgtacgctacctggccctgggccat
ataaaactggtcctggaggccttgcgggaacggggacgtttgctccaaaacgccccgcac
ctggtcaccatccaatccttcatcatccctaccttctcttggtgggacaagctagtctac
ggcctaggcttgacgctctatgatctgatggccggcagacttcgccttcgccgcaccgcc
tttctctctgcccaggaaaccgctcaacagctccccaacattaaaaccaaaggcctaacc
ggcggcgtgcagtattttgatggacagtttgatgatacccgactggccatcaatctggcc
cagacctgcgccgagcaaggcggcctcttgctgaattacatgccggtggtcaatctgttg
aaagacgctaggggaaaagttattggtgtaaccgcccaagatattgagtttggtcaggag
tatgtcatccaagccaagacagtaattaatgccacgggcgtttttgtcaacagcatccta
cacatggacgcgcccgcgcagcagcccttggtacggcccagtcagggcgtgcatgtggtg
ctggaccagtccttcctgaaaggcgagaatgccctaatgattccgaagacctctgacgga
cgcgtgctctttatggtgccgtggcatgggtatctgctggtaggcaccacggatacgctg
gtcaatgaaaccagcctggagccgaagccgcaggaacaggagattgattttatcctggag
acggccagccactacctggcgcgcaaacccacccgggcagacgtgctgagcgtctttgcc
ggacagcgtcctttggcggcccccaccatccacacccataagaccaaagagatttcacgc
agccacagcctgttggtagcgccgtctggcctcatcacggtcacaggcggcaagtggacc
acctaccgccaaatggccgaggatgcgattgatttggccattaccaaaggttttttactt
cctcttgattgtcaaacagcccagttgaaaattcatggctatacagtagaggaaaaccca
gcagacccactggccatctatggcacagacaaagtaggaatcttagccttggttcagcaa
ttcccagacttgggcattccacttcatccaaacttttctcacatcgccgctgaagtagtt
tgggccgcgcaatatgaaatggcgagaaccgtggaggatgtcttggctagaaggcttcgg
gtgctgtttctggatgcccgagcggcactggagatggctccaaaggtggctcaattaatg
gcggttgccttacataaagatgcggcttgggaagaaaatcaaattcatcagttcacgcaa
ttggcaagccagtatattttgtag

DBGET integrated database retrieval system