KEGG   Rufibacter sp. DG15C: TH61_07870Help
Entry
TH61_07870        CDS       T04326                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
rud  Rufibacter sp. DG15C
Pathway
rud00380  Tryptophan metabolism
rud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rud00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    TH61_07870
Enzymes [BR:rud01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     TH61_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AMM52830
UniProt: A0A127B614
LinkDB All DBs
Position
1840199..1841473
Genome map
AA seq 424 aa AA seqDB search
MTFQNTLAFAQAQDAADSLRNFREQFHIPQQNGQDTVYLCGNSLGLQPKSARAAVEEEMH
KWATLGVEGHFTGDTPWFTYHKALAGPSARIVGAKPEEVVIMNQLTVNLHLMLVSFYQPK
EGRYKILTEAGAFPSDQYALETQVKFHGYTPEDAIIEISPRKGETTWRNEDILQAIQEHG
DELALVMMGGVHYYTGQVFDMAAITQAAHAMGALCGFDLAHAAGNVPLQLHDWDVDFAVW
CTYKYMNSGPGGTSGAFVHERHANNPNLPRFAGWWGHDQQERFQMKKGFIPMAGAEGWQL
SNAQILPLAVHKASLALFEEAGIKNLRAKSERLTAYLEYLIKELNQPKELLEIITPSAPE
ARGCQISLLVNQNGRQLFDTLMANGFILDWREPNVIRVAPTPMYNTFEDVYRFGQFLAAH
FRND
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcaaaatacgttggcctttgcccaggcccaagatgcggcagattcgttacgc
aatttcagagagcagtttcacatcccgcagcaaaacggacaggacacggtctacctctgc
ggaaactctttagggcttcagcctaaatctgccagagcggcggtagaggaggagatgcac
aagtgggctaccctgggcgtggaaggacattttaccggagacacgccttggttcacctac
cacaaagccctggccggaccctctgcccgcattgtgggcgccaagcccgaggaggtggtc
atcatgaaccaactcaccgtgaacctgcacctcatgctggtgtcgttctatcaacccaaa
gaaggccgctacaagattctaaccgaagccggtgctttccccagtgaccagtacgcgctg
gagacgcaggtgaagttccatggctataccccagaagacgccatcattgaaatctcgccg
cgcaaaggggagactacctggcgcaacgaagacattctgcaagccatccaagagcacggc
gatgagctagccttggtcatgatgggcggcgtgcattactacaccgggcaggtgtttgac
atggcggccatcacccaagcggcgcatgccatgggcgcgttatgcggttttgacttggca
cacgcggcaggcaatgtgcctttgcaattgcatgactgggacgtggactttgccgtgtgg
tgtacctacaaatacatgaactcgggtccgggcggaacctctggtgcctttgtgcatgag
cgtcacgctaacaatcccaacctgccgcgctttgccggttggtggggccatgaccagcaa
gagcgctttcagatgaagaagggttttattcctatggccggcgccgaaggctggcaactt
tccaacgcacaaatcctgcccttggcagtgcataaagcgtctctggccttgtttgaagaa
gccggcattaaaaacctgcgcgctaagagcgaacgcctgactgcctacttggagtattta
atcaaagagctgaaccagcccaaagagctgctggaaatcatcacaccgtcggcgcctgag
gccagaggctgtcagatttccctgctcgtgaaccagaacggacgtcaactgtttgacacg
ctcatggccaacggtttcatattagattggcgtgaacccaacgtgatcagagtggccccc
acacctatgtacaacacctttgaggacgtctatcggttcgggcagtttttggcagcacac
tttaggaatgactaa

DBGET integrated database retrieval system